KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735023
Entry
103735023         CDS       T03372                                 

Gene name
Mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04024  cAMP signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04137  Mitophagy - animal
ngi04140  Autophagy - animal
ngi04141  Protein processing in endoplasmic reticulum
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi04217  Necroptosis
ngi04310  Wnt signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04530  Tight junction
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04723  Retrograde endocannabinoid signaling
ngi04728  Dopaminergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04926  Relaxin signaling pathway
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05231  Choline metabolism in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103735023 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103735023 (Mapk8)
   04012 ErbB signaling pathway
    103735023 (Mapk8)
   04014 Ras signaling pathway
    103735023 (Mapk8)
   04310 Wnt signaling pathway
    103735023 (Mapk8)
   04668 TNF signaling pathway
    103735023 (Mapk8)
   04068 FoxO signaling pathway
    103735023 (Mapk8)
   04071 Sphingolipid signaling pathway
    103735023 (Mapk8)
   04024 cAMP signaling pathway
    103735023 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103735023 (Mapk8)
   04137 Mitophagy - animal
    103735023 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    103735023 (Mapk8)
   04215 Apoptosis - multiple species
    103735023 (Mapk8)
   04217 Necroptosis
    103735023 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103735023 (Mapk8)
   04530 Tight junction
    103735023 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103735023 (Mapk8)
   04621 NOD-like receptor signaling pathway
    103735023 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    103735023 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    103735023 (Mapk8)
   04660 T cell receptor signaling pathway
    103735023 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    103735023 (Mapk8)
   04659 Th17 cell differentiation
    103735023 (Mapk8)
   04657 IL-17 signaling pathway
    103735023 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    103735023 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103735023 (Mapk8)
   04920 Adipocytokine signaling pathway
    103735023 (Mapk8)
   04912 GnRH signaling pathway
    103735023 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    103735023 (Mapk8)
   04917 Prolactin signaling pathway
    103735023 (Mapk8)
   04926 Relaxin signaling pathway
    103735023 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    103735023 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    103735023 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    103735023 (Mapk8)
   04722 Neurotrophin signaling pathway
    103735023 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103735023 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103735023 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735023 (Mapk8)
   05231 Choline metabolism in cancer
    103735023 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103735023 (Mapk8)
   05212 Pancreatic cancer
    103735023 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103735023 (Mapk8)
   05012 Parkinson disease
    103735023 (Mapk8)
   05016 Huntington disease
    103735023 (Mapk8)
   05017 Spinocerebellar ataxia
    103735023 (Mapk8)
   05020 Prion disease
    103735023 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    103735023 (Mapk8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103735023 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103735023 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    103735023 (Mapk8)
   04931 Insulin resistance
    103735023 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103735023 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103735023 (Mapk8)
   05135 Yersinia infection
    103735023 (Mapk8)
   05133 Pertussis
    103735023 (Mapk8)
   05152 Tuberculosis
    103735023 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103735023 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    103735023 (Mapk8)
   05161 Hepatitis B
    103735023 (Mapk8)
   05171 Coronavirus disease - COVID-19
    103735023 (Mapk8)
   05162 Measles
    103735023 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103735023 (Mapk8)
   05169 Epstein-Barr virus infection
    103735023 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103735023 (Mapk8)
   05142 Chagas disease
    103735023 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103735023 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103735023 (Mapk8)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103735023 (Mapk8)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103735023 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 103735023
NCBI-ProteinID: XP_008832343
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSPSVNDVSSMSTDPTLASDTDSSLEAST
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgataccagaatttaaaacctataggctcaggagctcaaggaatagtg
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaaccaaactcatgctaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacaaaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagcaatatagtagtaaaa
tcagactgcactttgaagattcttgattttggactggctaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgatactacagagcaccggaggtcatccttggcatg
ggctacaaggagaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
cttggaacaccttgtcctgaattcatgaagaaactgcagccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactattccctgatgtacttttc
ccagctgactcagagcacaacaaactgaaagctagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatccaaaaggatctcagtagatgaagctcttcagcacccgtac
atcaatgtctggtatgatccttcagaagcagaagctccaccaccaaagatccctgacaag
cagttggatgaaagggaacacacaatagaagagtggaaagagctgatctacaaggaagtg
atggacttggaggagagaaccaagaatggtgtcatccgggggcaaccctctcctttaggt
gcagcagtgatcaatggctctcagcatccttcgtcatcaccgtctgtcaatgatgtgtct
tcaatgtccacagatccgacgttggcttcggatacagacagcagtctggaagcatcaact
ggacctctgggctgctgtagatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748972
Entry
103748972         CDS       T03372                                 

Gene name
Mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04024  cAMP signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04137  Mitophagy - animal
ngi04140  Autophagy - animal
ngi04141  Protein processing in endoplasmic reticulum
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi04217  Necroptosis
ngi04310  Wnt signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04530  Tight junction
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04723  Retrograde endocannabinoid signaling
ngi04728  Dopaminergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04926  Relaxin signaling pathway
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05231  Choline metabolism in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103748972 (Mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748972 (Mapk10)
   04012 ErbB signaling pathway
    103748972 (Mapk10)
   04014 Ras signaling pathway
    103748972 (Mapk10)
   04310 Wnt signaling pathway
    103748972 (Mapk10)
   04668 TNF signaling pathway
    103748972 (Mapk10)
   04068 FoxO signaling pathway
    103748972 (Mapk10)
   04071 Sphingolipid signaling pathway
    103748972 (Mapk10)
   04024 cAMP signaling pathway
    103748972 (Mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103748972 (Mapk10)
   04137 Mitophagy - animal
    103748972 (Mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    103748972 (Mapk10)
   04215 Apoptosis - multiple species
    103748972 (Mapk10)
   04217 Necroptosis
    103748972 (Mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103748972 (Mapk10)
   04530 Tight junction
    103748972 (Mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103748972 (Mapk10)
   04621 NOD-like receptor signaling pathway
    103748972 (Mapk10)
   04622 RIG-I-like receptor signaling pathway
    103748972 (Mapk10)
   04625 C-type lectin receptor signaling pathway
    103748972 (Mapk10)
   04660 T cell receptor signaling pathway
    103748972 (Mapk10)
   04658 Th1 and Th2 cell differentiation
    103748972 (Mapk10)
   04659 Th17 cell differentiation
    103748972 (Mapk10)
   04657 IL-17 signaling pathway
    103748972 (Mapk10)
   04664 Fc epsilon RI signaling pathway
    103748972 (Mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103748972 (Mapk10)
   04920 Adipocytokine signaling pathway
    103748972 (Mapk10)
   04912 GnRH signaling pathway
    103748972 (Mapk10)
   04914 Progesterone-mediated oocyte maturation
    103748972 (Mapk10)
   04917 Prolactin signaling pathway
    103748972 (Mapk10)
   04926 Relaxin signaling pathway
    103748972 (Mapk10)
   04935 Growth hormone synthesis, secretion and action
    103748972 (Mapk10)
  09156 Nervous system
   04728 Dopaminergic synapse
    103748972 (Mapk10)
   04723 Retrograde endocannabinoid signaling
    103748972 (Mapk10)
   04722 Neurotrophin signaling pathway
    103748972 (Mapk10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103748972 (Mapk10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103748972 (Mapk10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748972 (Mapk10)
   05231 Choline metabolism in cancer
    103748972 (Mapk10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103748972 (Mapk10)
   05212 Pancreatic cancer
    103748972 (Mapk10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103748972 (Mapk10)
   05012 Parkinson disease
    103748972 (Mapk10)
   05016 Huntington disease
    103748972 (Mapk10)
   05017 Spinocerebellar ataxia
    103748972 (Mapk10)
   05020 Prion disease
    103748972 (Mapk10)
   05022 Pathways of neurodegeneration - multiple diseases
    103748972 (Mapk10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103748972 (Mapk10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103748972 (Mapk10)
   04932 Non-alcoholic fatty liver disease
    103748972 (Mapk10)
   04931 Insulin resistance
    103748972 (Mapk10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103748972 (Mapk10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103748972 (Mapk10)
   05135 Yersinia infection
    103748972 (Mapk10)
   05133 Pertussis
    103748972 (Mapk10)
   05152 Tuberculosis
    103748972 (Mapk10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103748972 (Mapk10)
   05170 Human immunodeficiency virus 1 infection
    103748972 (Mapk10)
   05161 Hepatitis B
    103748972 (Mapk10)
   05171 Coronavirus disease - COVID-19
    103748972 (Mapk10)
   05162 Measles
    103748972 (Mapk10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103748972 (Mapk10)
   05169 Epstein-Barr virus infection
    103748972 (Mapk10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103748972 (Mapk10)
   05142 Chagas disease
    103748972 (Mapk10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103748972 (Mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103748972 (Mapk10)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103748972 (Mapk10)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103748972 (Mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 103748972
NCBI-ProteinID: XP_008849975
LinkDB
Position
Un
AA seq 478 aa
MCNAPACSLCTLVFMSLNFLYYCSEPTLDVKLAFCQGFDKQVDVSHIAKQYNMSKSKVDN
QFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAK
RAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERM
SYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVT
RYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEF
MKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAK
RISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTK
NGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtgcaatgcacccgcatgctccctatgtactttggtatttatgagcctcaatttctta
tactactgcagtgaaccaaccttggatgtgaaacttgccttttgtcagggattcgataaa
caagtggatgtgtcacacattgccaaacagtacaacatgagcaaaagcaaagtggataat
cagttctacagcgtagaagtgggagactcaaccttcaccgttctcaagcgctatcagaac
ctgaagccaattggctctggggctcagggaatagtttgtgctgcatatgatgctgtcctt
gacagaaatgtggccattaagaagctcagcagaccctttcagaaccaaactcatgccaag
agagcttaccgggagctggtcctcatgaagtgtgtgaaccataaaaacattattagttta
ttaaatgttttcacaccccagaaaacgctggaggaattccaagatgtttatttagtaatg
gaactgatggatgccaacttgtgtcaggtgattcaaatggaactagaccatgaacggatg
tcttacttgctgtatcaaatgttgtgtggcatcaagcatcttcactcagcaggaattatt
cacagggatttaaaaccaagtaatattgtagtcaagtctgattgcacattgaaaatcctt
gactttggactggccaggacagcaggcacaagcttcatgatgactccgtatgtggtgaca
cgatattacagagcccccgaggtcatcctgggaatgggctacaaggagaacgtggatata
tggtctgtgggatgcattatgggagaaatggttcgccacaaaatcctctttcccggaagg
gactatattgaccagtggaacaaagtaattgagcaactaggaacaccttgtccagaattc
atgaagaaattgcaacccacagtaagaaactacgtggagaatcggcccaagtatgcagga
ctcaccttccccaagctctttccagactccctcttcccagcggactctgagcacaataaa
cttaaagccagccaagccagggatttattgtcaaagatgctagtgattgacccagcaaag
aggatatcagtggatgatgccttacagcatccatacatcaacgtctggtacgacccagct
gaagtggaggcgcctccgcctcagatatatgataaacagctggatgaaagagaacacacc
attgaagaatggaaagaacttatctacaaggaagtaatgaattcagaagaaaagactaaa
aatggcgtagtaaaaggacagccttctccttcaggtgcagcagtgaacagcagtgagagt
ctccctccatcctcgtctgtcaatgacatctcttctatgtccaccgaccagaccctggca
tctgacactgacagcagcctggaagcctcagcgggaccgctgggttgttgcaggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749366
Entry
103749366         CDS       T03372                                 

Gene name
Mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04024  cAMP signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04137  Mitophagy - animal
ngi04140  Autophagy - animal
ngi04141  Protein processing in endoplasmic reticulum
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi04217  Necroptosis
ngi04310  Wnt signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04530  Tight junction
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04723  Retrograde endocannabinoid signaling
ngi04728  Dopaminergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04926  Relaxin signaling pathway
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05231  Choline metabolism in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103749366 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103749366 (Mapk9)
   04012 ErbB signaling pathway
    103749366 (Mapk9)
   04014 Ras signaling pathway
    103749366 (Mapk9)
   04310 Wnt signaling pathway
    103749366 (Mapk9)
   04668 TNF signaling pathway
    103749366 (Mapk9)
   04068 FoxO signaling pathway
    103749366 (Mapk9)
   04071 Sphingolipid signaling pathway
    103749366 (Mapk9)
   04024 cAMP signaling pathway
    103749366 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103749366 (Mapk9)
   04137 Mitophagy - animal
    103749366 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    103749366 (Mapk9)
   04215 Apoptosis - multiple species
    103749366 (Mapk9)
   04217 Necroptosis
    103749366 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103749366 (Mapk9)
   04530 Tight junction
    103749366 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103749366 (Mapk9)
   04621 NOD-like receptor signaling pathway
    103749366 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    103749366 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    103749366 (Mapk9)
   04660 T cell receptor signaling pathway
    103749366 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    103749366 (Mapk9)
   04659 Th17 cell differentiation
    103749366 (Mapk9)
   04657 IL-17 signaling pathway
    103749366 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    103749366 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103749366 (Mapk9)
   04920 Adipocytokine signaling pathway
    103749366 (Mapk9)
   04912 GnRH signaling pathway
    103749366 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    103749366 (Mapk9)
   04917 Prolactin signaling pathway
    103749366 (Mapk9)
   04926 Relaxin signaling pathway
    103749366 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    103749366 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    103749366 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    103749366 (Mapk9)
   04722 Neurotrophin signaling pathway
    103749366 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103749366 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103749366 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103749366 (Mapk9)
   05231 Choline metabolism in cancer
    103749366 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103749366 (Mapk9)
   05212 Pancreatic cancer
    103749366 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103749366 (Mapk9)
   05012 Parkinson disease
    103749366 (Mapk9)
   05016 Huntington disease
    103749366 (Mapk9)
   05017 Spinocerebellar ataxia
    103749366 (Mapk9)
   05020 Prion disease
    103749366 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    103749366 (Mapk9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103749366 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103749366 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    103749366 (Mapk9)
   04931 Insulin resistance
    103749366 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103749366 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103749366 (Mapk9)
   05135 Yersinia infection
    103749366 (Mapk9)
   05133 Pertussis
    103749366 (Mapk9)
   05152 Tuberculosis
    103749366 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103749366 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    103749366 (Mapk9)
   05161 Hepatitis B
    103749366 (Mapk9)
   05171 Coronavirus disease - COVID-19
    103749366 (Mapk9)
   05162 Measles
    103749366 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103749366 (Mapk9)
   05169 Epstein-Barr virus infection
    103749366 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103749366 (Mapk9)
   05142 Chagas disease
    103749366 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103749366 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103749366 (Mapk9)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103749366 (Mapk9)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103749366 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 103749366
NCBI-ProteinID: XP_017658453
LinkDB
Position
Un
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSSAAPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagcaaatgcgatagtcagttttacagtgtgcaagtggcggactcaaccttc
actgtcctaaaacgttaccagcagttgaaaccaattggctcaggagcccaaggaattgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcataccgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagcttgttaaatgtgttcacaccacaaaaaactctagaagaa
tttcaagatgtgtacttggttatggaattaatggatgctaacttgtgtcaggttattcat
atggagttggaccatgagagaatgtcctacctgctttaccagatgctctgtggtattaag
catctgcattcagctggcatcattcatagagatttgaagcctagcaacattgtagtaaaa
tcagactgtacccttaagatccttgactttggcctggcccggacagcctgcaccaacttt
atgatgaccccctacgtggtaactcgctattatcgggctccagaagtcatcctgggcatg
ggctacaaggaaaatgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
ctgggaacaccatcagcagagttcatgaaaaaacttcagccaactgtgagaaactatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattt
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctattatcaaaa
atgttagtgattgatcctgacaagcgaatctctgtggatgaagccttgcgtcacccgtat
atcactgtttggtatgaccccgcagaagcagaagcgccaccacctcagatttacgatgcc
cagttggaagaaagggagcatgcgattgaagagtggaaagagctaatttacaaagaagta
atggactgggaagaaagaagcaagaacggtgttgtgaaagatcagccttcagatgcagca
gtaagtagcagtgccgctccttctcagtcatcatctatcaatgacatttcatccatgtcc
actgagcagacactggcctcagacacagacagcagtctcgatgcctcaacaggacccctt
gaaggttgtcgatga

DBGET integrated database retrieval system