KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735168
Entry
103735168         CDS       T03372                                 

Gene name
Apc
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04810  Regulation of actin cytoskeleton
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103735168 (Apc)
   04390 Hippo signaling pathway
    103735168 (Apc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103735168 (Apc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103735168 (Apc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735168 (Apc)
   05206 MicroRNAs in cancer
    103735168 (Apc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103735168 (Apc)
   05225 Hepatocellular carcinoma
    103735168 (Apc)
   05226 Gastric cancer
    103735168 (Apc)
   05217 Basal cell carcinoma
    103735168 (Apc)
   05213 Endometrial cancer
    103735168 (Apc)
   05224 Breast cancer
    103735168 (Apc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103735168 (Apc)
   05022 Pathways of neurodegeneration - multiple diseases
    103735168 (Apc)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103735168 (Apc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103735168 (Apc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103735168 (Apc)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103735168 (Apc)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ngi04812]
    103735168 (Apc)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103735168 (Apc)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103735168 (Apc)
Cytoskeleton proteins [BR:ngi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     103735168 (Apc)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 103735168
NCBI-ProteinID: XP_008832533
LinkDB
Position
Un
AA seq 2869 aa
MSSSLRSGPVAALPTSFPPSALGSWSSGGGRGRVGPKGRRPGGARACGRGASAWQEVLKQ
LQGSIEDESMTSSGQIDLLERLKEFNLDSNNFPGVKLRSKMSLRSYGSREGSVSSRSGEC
SPVPMGSFPRRAFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRID
SLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILR
IRQILQSQATETERSSQSKHEAGSHEAERQHEGQGVAESNMATSGSGQSSATRVDHDTAS
VLSSSSTHSAPRKLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLL
EQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG
RKATRGISSQELGQGLSGGLQAIAELLQVDCEMYGLTNDHYSVTLRRYAGMALTNLTFGD
VANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKAL
MECALEVRKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAII
ESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNP
KDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSL
HVRKQKALEAELDAQHLSETFDNIDNLSPKASHRNKQRHKQNLYGDYVFDSNRHDDNRSD
NFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERSIGLSTFHPATENSGT
SSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSPSELHCVTDERSAARRSSASHTHS
NTYSFTKSENSNRTCSMPYAKVEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDES
KFYSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARP
KHIIEDEIKQNEQRQSRSQNTTYPTYPENTDDKHLKFQPHFGQQECVSPYRSRGTSGSEM
NRVGSSHGINQNVNQTLCQEDDYEDDKPTNYSERYSEEEQHEEEERATNYSIKYNEEKHH
VDQPIDYSLKYATDISSSQKPSFPFSKSSSAQNTKTEHISSSSENISTPSSNAKRQNQLH
PTSAQRNGQTQKGSTCKVSSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTT
QETDPADTLQIAEIKENSVTRATEDPVSEVPAVSPHVRAKSSRLQASSLSSESTRHKAVE
FSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGM
VSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTVQTKREVPKTKVPPAEKRESGPKQAAVN
AAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDN
GNETEPEQPEESKGNGEKEAEKPDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKL
AQTASKLPPPVARKPSQLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTA
TSLSDLTIESPPNELAAGEGIRAGVQSGELEKRDTIPTEGRSTDEAQRGKISSVAVPDLD
DNKTEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASVSSSGTIKNQIDSKKKKPTS
PVKPMPQNTEFRTRVRKNTDQKNNLNAEQTLSDNKDSKKQNLKINSKDFNDKLPTNEDRV
RGSFTFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKESKDSEAKV
TCPAEPASSQQSASKSQAGTKQPVSRGQPKAVLQKQPTFPQSSKDNPDRGAATDEKLQNF
AIENTPVCFSRNSSLSSLSDIDQENNNNKENEPIKETEPADSQGEPSKRQASGYAPKSFH
VEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKRPSRLKGDNEKHTPRNMGGILA
EDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSD
SILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESENKGIKGGKK
VYKSLITGKVRSNSEISSQMKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPL
KTPASKSPSEGQTATTSPRGTKPSVKSELSPVMRQTSQISASNKGPSRSGSRDSTPSRPA
QQPLSRPMQSPGRNSISPGRNGISPPNKLSHLPRTSSPSTASTKSSGSGKMSYTSPGRQM
SQQNLSKQTGLSKNASSIPRSESASKGLNQMNNGNGSNKKVELSRMSSTKSSGSESDRSE
RPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSL
STHPSVQTGGWRKLPPNLSPTIEYNDGRPVKRHDIARSHSESPSRLPINRSGTWKREHSK
HSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGPKQTKENQVSTKGVWR
KIKESEISPTNTASQTTSSGAANGAEPKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGR
SPTGNTPPVIDSVSEKGNPNIKDSKDNQGKQSVGNGSPPGHTVGLENRLNSFIQVDAPDQ
KGTETKPGQSHPVLAETSESSIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSS
ADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV
NT seq 8610 nt   +upstreamnt  +downstreamnt
atgtcctcctccttgcgctcggggccggtcgccgctttgcccacctcgttccctccgtcg
gctctcgggtcctggagctccggcggcggccggggccgagtggggccgaaggggaggcgc
cccggcggtgcccgagcttgtggccgtggagctagcgcctggcaggaagtacttaaacag
ctacaaggaagtattgaagatgaaagtatgacttcctctggacagatagacttactagag
cgtcttaaagaatttaacttagatagcaacaattttcctggagtgaaattacggtcaaaa
atgtccctccgttcttatggaagccgagaaggatcagtatccagtcgttcaggagagtgc
agtcctgttcccatgggctcatttccaagaagagcgtttgttaatggaagcagagaaagt
actggatatttggaagagcttgagaaagaaaggtcattactccttgctgatcttgacaaa
gaagaaaaggaaaaagactggtattatgctcaacttcagaatctcactaaaagaatagat
agccttcctttaactgaaaatttttccttacaaacagatatgacaagaaggcagttagaa
tacgaagcaaggcaaatcagagttgcaatggaagaacagcttggtacttgccaggatatg
gaaaaacgagctcagcgacgaatagccagaatccagcaaatagagaaggacatacttcgt
atacgacagattttacaatcccaagcaacagaaacagaaaggtcatctcagagcaaacat
gaggctggctcccatgaagctgaacggcagcatgaagggcaaggagtggcagaaagcaac
atggcaacttctggtagtggccagagttcagccacacgagtggatcatgacacagccagt
gttttgagttctagcagcacacactctgctcctcgaaagctgacaagtcatctaggaacc
aaggtggaaatggtgtattcattgttatcaatgcttggtactcatgataaggatgatatg
tcacgaactttgctagctatgtctagctcccaagacagctgtatatccatgcgacagtct
ggatgtcttcctctcctcatccagcttttacatggcaatgacaaagactctgtattgttg
ggaaattcccggggcagtaaagaggctcgggccagggccagtgcggcactccacaacatc
attcactcacagcctgatgacaagagaggcaggcgtgaaatccgagtccttcatcttttg
gaacagatacgagcttactgtgaaacctgttgggagtggcaggaagcccatgaacaaggc
atggaccaggacaaaaatccaatgccagctcctgttgaacatcagatctgtcctgctgtg
tgtgttctaatgaaactttcatttgatgaagagcacagacatgcaatgaatgaacttggt
aggaaggctacccggggcatttcatcacaggagctagggcaggggctttcagggggactg
caggccattgcagaattgttgcaagtagactgtgagatgtacgggcttactaatgaccac
tacagtgtcactttacgacggtatgctggaatggctctgacaaacttgacctttggggat
gtagccaacaaggctacattatgttctatgaaaggctgcatgagagcactcgtggcccaa
ttaaaatccgaaagtgaagacttacaacaggttattgcaagtgttttgaggaatttgtct
tggcgagcagatgtaaatagcaaaaagacgctgcgggaagttgggagtgtgaaagccttg
atggaatgtgctttggaagttagaaaggaatcaaccctcaaaagcgtattgagtgcctta
tggaatctgtcagcacattgcacagaaaataaagctgatatatgtgctgtggatggagca
cttgcatttttggttggcactctgacttaccggagccaaacaaatactttagccattatt
gaaagtggaggtgggatattacggaatgtatccagcttgatagctacaaatgaggaccac
aggcaaatcctacgagagaacaattgcctccaaaccttattacagcacttgaaatctcac
agtctgacaatagtcagtaatgcatgtggaactctgtggaacctttcagcaagaaatcct
aaagaccaggaagcattatgggacatgggggcagttagcatgcttaagaacctcattcat
tcaaagcacaaaatgatcgctatgggaagtgctgcagctctaaggaatctcatggcaaac
agacctgcaaagtataaggatgccaatattatgtctcctggttcaagtttgccatctctt
catgttaggaaacaaaaagccctagaagcagaattagatgctcaacatttatcagaaact
tttgacaatattgacaatttaagtcccaaggcatctcatcggaacaagcagagacataag
cagaatctttatggtgactatgtttttgacagcaatcgacatgacgacaataggtcagac
aattttaataccggaaacatgactgttctttcaccatacttgaatacaacagtgttgccc
agctcttcctcatcaaggggaagtttagatagttctcgctctgaaaaagatagaagtttg
gagagagaacgaagtatcggcctaagcacttttcatccagcaacagaaaattcaggaacc
tcttcaaagagaggtttgcagatctctaccactgcagcccagatcgccaaagtcatggaa
gaagtatcagccattcatacctcccaagaagacaggagttctggttctcctagcgaactg
cattgtgtgacagacgagaggagtgcagcaagaagaagctctgcttcccacacacattca
aacacgtacagtttcactaagtcagaaaattcaaacaggacgtgctctatgccttatgcc
aaagtggaatataagagatcttcaaatgatagcttaaatagtgtcagcagtagtgatggc
tatggtaaaagaggtcagatgaagccctcaattgaatcctattctgaagatgatgaaagc
aaattttacagttatggtcagtacccagctgacctcgcccataaaatacatagcgcaaat
catatggatgataatgacggagaactggatacacccatcaattacagtcttaaatattca
gatgagcagttgaactctggaaggcaaagtccttcacagaatgaaagatgggcaagaccc
aagcatataatagaagatgaaataaagcaaaacgagcaaagacaatcaagaagccagaat
accacttaccctacatatcctgagaacactgatgacaaacacctcaagttccagccacat
ttcggacagcaagaatgtgtttccccatataggtcaaggggaaccagtggttcagaaatg
aatcgagtgggttctagtcatggaattaatcaaaatgtaaaccagactttgtgtcaagaa
gatgattatgaagatgataagcctaccaactatagtgaacgttactctgaggaagaacag
catgaagaagaagagagagccacaaattacagcataaaatataatgaagagaaacatcat
gtggatcagcctattgattacagtttaaaatatgccactgacatttcttcctcacagaaa
ccatcatttccgttctcaaagagttcatcggcacaaaacaccaaaactgaacacatctct
tcaagcagtgagaatatatccacaccttcatctaatgccaagaggcagaatcagctgcat
ccaacttcagcacagagaaatgggcagactcagaaaggtagcacttgcaaagtttcctct
atcaaccaagaaacaatacagacttactgtgtagaagacacccccatatgtttctcaagg
tgtagttcattatcatctttgtcatcagctgaagatgaaataggatgtaatcagacaaca
caggaaacagatccggctgatactctgcaaatagcagaaataaaagagaacagcgtgact
agagcaactgaagatcctgtaagtgaagttccagcagtgtccccgcatgttagagccaag
tccagcagactccaggcttccagcttatcttcagaatcaaccaggcataaagctgttgaa
ttttcttcaggagccaagtctccttccaaaagcggtgctcagacacccaaaagtccacca
gagcactatgttcaggagaccccgctcatgtttagcagatgcacttctgtcagttcactt
gacagttttgagagtcgctccattgccagctctgttcagagtgagccatgcagtggaatg
gtaagtggcattattagcccaagtgaccttccagatagccctggacagaccatgccacca
agcagaagcaaaacccctccacctcctcctcaaacagtgcagaccaaacgagaggtcccc
aaaaccaaagtacctcctgctgagaagagagagagtggacccaagcaagctgctgtaaac
gctgcggttcagagggtgcaggttcttccagatgcggatactttattacattttgccaca
gaaagtactccagatggattttcttgttcatctagcctgagtgctctgagccttgatgaa
ccatttatacagaaagatgtggagttaaggataatgcctccagttcaggaaaatgacaat
ggaaatgagacagaaccagagcagcctgaagaatcaaagggaaatggggaaaaagaggca
gaaaaacctgactctgaaaaagacctactagatgattcagacgatgatgatattgaaata
ttagaagaatgtattatttctgccatgccaacaaagtcatcacgcaaagccaaaaagcta
gcccagactgcttcaaaattacctccgcctgtggcaaggaaaccaagccaactgcctgtg
tacaaacttctgccatcacaaaacaggttgcaagcacaaaagcatgttagctttacacca
ggagatgatatgccccgggtatactgtgtagaggggacacctataaacttttccacagct
acgtctctcagtgatctgaccatagaatcccctccaaatgagttagctgctggagaaggg
attagagcaggggtacagtctggtgaactggaaaaacgagataccattcctacagaaggt
agaagtacagatgaggcacaaagagggaaaatctcatctgtggctgtgcctgacctggat
gacaataaaacagaggaaggagacattcttgcagaatgcattaattctgctatgcccaaa
ggaaaaagtcacaagcctttccgagtgaaaaagataatggaccaggtccaacaggcctct
gtgtcttcatctggaactatcaaaaatcaaatagatagtaagaaaaagaagcctacgtca
ccggtaaaacccatgccacaaaatactgaatttaggacacgtgtgagaaagaacacagat
caaaaaaataacttaaatgctgaacaaactttatcagataacaaagattcaaagaaacag
aatttgaaaattaactctaaggacttcaatgataagctaccaactaatgaagatagagtc
aggggaagcttcacttttgattcacctcatcattacacccctattgaaggaactccttat
tgcttttcacgaaatgattctttgagttctctagactttgatgatgatgatgttgacctt
tccagggaaaaggctgaattaagaaaagggaaagaaagtaaggattcagaagctaaagtt
acctgccccgcagagccagcctcaagccagcagtctgctagtaagtcacaggctggcaca
aaacaaccagtaagtagaggacagcctaaagcagtgctgcagaaacaacctactttcccc
cagtcatccaaagacaatccagatagaggggcagcaactgatgaaaaactacagaatttt
gctattgaaaatactccagtttgcttttctcgtaattcctctctgagttctcttagtgac
atcgaccaagaaaacaacaacaacaaagaaaatgaacctatcaaagaaactgagcctgcc
gactctcaaggagaaccaagcaagcgccaggcttcgggctatgctcctaagtcatttcat
gttgaagatacccctgtctgtttctcaagaaacagttctctcagctctcttagtattgac
tctgaagatgacctgttgcaggaatgtataagttctgcaatgccaaaaaagaaaaggcct
tcaagactcaagggggataatgaaaagcatactcccagaaacatgggtggcatattagcc
gaagatttgacccttgatttgaaagatatacagaggccagattcagaacatggtttatcc
cctgattcagagaatttcgactggaaagctattcaggaaggtgcaaattccatagtgagt
agtttgcatcaagctgctgctgctgcgtgcttgtctagacaagcctcatctgactctgat
tccattctgtcactgaaatcaggcatttccctggggtcaccttttcatcttacacctgat
caagaggaaaaacccttcacaagtaataaaggcccaagaattctcaagcctggggagaaa
agtacattagaaactaaaaagatagaatctgaaaacaaaggaatcaaaggtggaaaaaaa
gtttataaaagtttgatcactggaaaagttcgctctaattcagaaatttcaagccaaatg
aaacagccccttcagacaaacatgccttcaatctcacgaggtaggacaatgattcatatt
ccaggagttcgaaatagttcttcaagtacaagtcctgtttctaaaaaaggcccacccctt
aagacgccagcctccaaaagtcctagtgaaggtcagacagccaccacctctcctagagga
actaagccatcggtgaaatcagagctgagccctgttatgaggcaaacttcccaaataagt
gcatcaaataaagggccttctagatcaggatctagagattccactccttccagacctgca
cagcagccattaagtaggccaatgcagtctccaggacgaaactcaatctcccctggtaga
aatggaataagtcctcctaacaaattatctcacctgcccaggacatcatcccctagtact
gcctcgactaagtcctcgggttctgggaaaatgtcatatacgtccccaggcagacagatg
agccaacaaaaccttagcaagcaaacaggcttatctaagaatgctagtagtatcccaaga
agtgagtctgcctctaaagggctgaatcagatgaataatggtaatgggtctaacaaaaag
gtcgaactttctagaatgtcttcaactaagtcaagtggaagtgaatcagatagatcagaa
agacctgtattagtacgccagtctactttcatcaaagaagctcccagcccaaccttaagg
aggaagttggaggaatctgcttcatttgagtcactttctccatcttctagaccagattct
cccactaggtcccaggcacaaacgccagttttaagtccttcccttccagatatgtctctg
tccacacacccgtctgttcagactggtggatggcgaaaactcccacctaatctcagtcct
actatagaatataatgatggaagacccgtgaagcggcatgatatagcacgctcccattct
gaaagtccttccagacttccaatcaataggtcaggaacttggaagcgtgaacacagcaag
cattcatcatcccttcctcgagtaagcacttggagaagaactggaagttcatcttctatt
ctttctgcttcatcagagtccagtgagaaagcaaaaagtgaggatgaaaaacatgtaaac
tctatttcaggacccaaacaaactaaagaaaaccaagtatccacaaaaggagtgtggaga
aaaataaaagaaagtgaaatttctcccacaaacactgcctctcagactacttcctcaggt
gctgcgaatggtgctgaaccaaaaactttaatttatcaaatggcacctgctgtttctaaa
acagaggatgtctgggtgagaattgaggactgtcccattaacaaccccagatccggaaga
tcgcccacagggaacactcccccagtgattgacagtgtttcagaaaagggaaatcccaac
ataaaagattcaaaagataatcagggaaaacaaagtgtgggcaatggcagtcctcctggg
cataccgtgggtctggaaaaccgcctgaactcctttattcaggtagatgccccagaccaa
aaaggaactgagacaaaaccaggtcaaagtcaccctgtccttgcagagactagtgaaagt
tctatagcagagcgcaccccattcagttcaagtagctccagcaaacacagttcacctagt
gggactgttgctgccagagtgactccctttaattacaacccaagccccaggaaaagcagc
gcagacagcacatcagcccggccgtctcagatacctacgccagtgaataacaacacaaag
aagagagattcaaagactgacagcacagaatccagtggaacgcaaagtcctaagcgccat
tctgggtcttaccttgtgacatctgtttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737324
Entry
103737324         CDS       T03372                                 

Gene name
Apc2
Definition
(RefSeq) APC2, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04810  Regulation of actin cytoskeleton
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103737324 (Apc2)
   04390 Hippo signaling pathway
    103737324 (Apc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103737324 (Apc2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103737324 (Apc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737324 (Apc2)
   05206 MicroRNAs in cancer
    103737324 (Apc2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103737324 (Apc2)
   05225 Hepatocellular carcinoma
    103737324 (Apc2)
   05226 Gastric cancer
    103737324 (Apc2)
   05217 Basal cell carcinoma
    103737324 (Apc2)
   05213 Endometrial cancer
    103737324 (Apc2)
   05224 Breast cancer
    103737324 (Apc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103737324 (Apc2)
   05022 Pathways of neurodegeneration - multiple diseases
    103737324 (Apc2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103737324 (Apc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103737324 (Apc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103737324 (Apc2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103737324 (Apc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ngi04812]
    103737324 (Apc2)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103737324 (Apc2)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103737324 (Apc2)
Cytoskeleton proteins [BR:ngi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     103737324 (Apc2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Arm_APC_u3 APC_r Arm Suppressor_APC SAMP DUF4795 bZIP_1 HALZ IL4
Other DBs
NCBI-GeneID: 103737324
NCBI-ProteinID: XP_008835380
LinkDB
Position
Un
AA seq 2276 aa
MATSVTSYEQLVRQVEALKAENSYLRQELQDNSSHLFKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQTDISSLYNLKFQPPTLHQEPSAQIPEGSPVHSSGPLKDSF
GELSRATIRLLEELDQERCFLLSEIEKEEKEKLWYYTQLQGLAKRLDELPHVETFSMQMD
LIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLEAQDRVQQTEPQAL
LAVKPVAVEEDPEAEVPTHPEDAPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSSSP
ESCVAMRRSGCLPLLLQILHSTEAGSGGRTGTPGAPGAKDARMRANAALHNIVFSQPDQG
LARKEMRVLHVLEQIRAYCETSWDWLQARDSGEGSSAGGTPVPIEPQICQATCAVMKLSF
DDEYRRAMNELGGLQAIAELLQVDYEMHKTTQDPLNLALRRYAGMTLTNLTFGDVANKAT
LCARRGCMEAIVAQLASDSEELHQVVSSILRNLSWRADINSKKVLREVGSMTALMECVLR
ATKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYRCQGNSLAVIESGGGI
LRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSPRDQELL
WDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQVTATAISPGTCVPSLYVRKQ
KALEAELDTRHLAQTLGHLEKQGLAEADSASKKPLPPLRHLDGLARDYASDSGCFDDDDA
PSLAAAATTAEPASPAMLSMFLSGPFLQGQALARTTAAHQGGSEAEKEAGGDTAVAIKAK
AKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGQAQSCSPCRGHEGGRHE
VGGRAHPLLRLKAAHTSLSNDSLNSSSTSDGYCPREHMQPCPLAALAEHREDLLNGQKRP
SRLDLDLPRGRAELPSQDTVVSDARVRTIKLSPTYQHVPLFDGATAAGVRPLAGPGASPG
AWKQAWMPGNSPSKVPEKLVGSPLPVASRVLQKLVAEDGPMSLSRCSSLSSLSSTGHAGP
SETGNLDDSDSSLEGLEEAGPGKSELDGAWQASRSTSLPVTIPAPHQGHSRGLGMEDATS
SSSENCVQETPLVLSRCSSVSSLGSFESQSIASSIPSDPCSGLGSGTVSPSELPDSPGQT
MPPSRSKTPPAPPGQPETSQFSLQWESYVKRFLDIADCRERCQPPSELDAGSVRFTVEKP
DENFSCASSLSALALHELYVQQDVELRLRPPACPERAGGSGGHRRRDEAAGRLEGPTSSN
SRARVAADKELELLRECLGAAVPARLHKVTSALMPGRRALPVPVYMLVPAPARDDDSGTD
SAEGTPVNFSSAASLSDETLQGHSRDQPCGPVDRQKPIGQAAPARRSAGHRPKAVGTGKN
TEQARGASRTRARLELPLSRPLSARSNRDGSSQVRTHGDGALQSLCLTTPTEEAVYCFYG
SDEEPPATAPPPRRASAIPRALKQEKSTKLAPPPMRAQPRMIVDETPPCYSLTSSASSLS
EPEVPERPASHLQGQELVATKDPGLGGRQDSFPSPRAEEELLQKCISSALPRHRPQVQGS
RRRKPRAARQNEVPRKCCEEVPGSDPASDLDSVEWKAIQEGANSIVTWLHQAAARASLEA
SSETDSVLSLASGLSPGSSLQPSKDRKGQQPGAGTEAVSVCHPEKQDTSSTKVSGNPCSP
GGSEKPRGVHQKTVTGEPAVLRGRTVIYMPSPVSRSQPKGVPGPCTKPRKMGSAGTTQPE
TATKSPSPGQLRSRSLHRPGKISELAAMNHPPRSATPPARLTKTPSSSSSQTSSASQPLP
RRSPLATLPSGSLLGPGESPVPKSPARALLAKQHKTQKSPVRIPFMQKPARRGPPPLAKP
APEPGPRGRAGAEGVPGVRGGRLGLVRMTSARSSGSESCTRSGFRRQLTFIKESPGLLHR
RRSELSSTGSTVSTASMAQVSSPCHGQPTLPAVFLCSSRCDELRVSPRQSPGPQQSPKSR
PGPTPRAPRRTSSESPSRLPVRTTPLQPEKVKRYASLPHISVARRQDSTVPVPAARTNAT
RRGSDSEARPLPRVAAPGTTWRRIRDEDVPYILRSTLPATALPLRGPSPEDSPSGTQQRK
TSDAVVQTEEVVTPKTNSSTSPSLESRDPPKAPATGPVAPLGSDVDGPVLAKLPCSVPFT
HEGLSVTVGGFPISRHGSPSRAARVSPFNYVPSPMAVASNSSVEKAPMSTPVSLLE
NT seq 6831 nt   +upstreamnt  +downstreamnt
atggccacctctgttacatcctatgagcagctggtacggcaggtggaggcattgaaggcg
gagaatagttacttgaggcaggagttacaggataactccagccacctgttcaagctggag
actgaaacctcaggcatgaaggaagtactgaaacacctgcagggcaagttagagcaggag
gcccgagtgttggtgtcctctggacagacagaagtgttggagcagctgaaggctctccag
actgacatcagcagtctatacaacctcaagttccagccacccaccctgcaccaggagccc
tctgcccagatcccagaggggagccctgtgcacagctctgggccactgaaggacagcttt
ggggagctgagccgggccaccatccgtctacttgaagaactggaccaggaaagatgcttc
ctgctgagtgagatagagaaggaagagaaggagaagctgtggtactacacacagcttcag
ggcctggccaagcgtctggacgagctgccgcacgtggaaacgttctcaatgcagatggat
ctgatccggcagcagctggagttcgaggcccagcacatccgctccctgatggaggagcgc
tttggcacctcggatgagatggtgcagcgcgcgcagatccgcgcttcccgcctggagcag
attgacaaggagctattggaggctcaagacagggtgcagcagacggaaccccaggcccta
ctggctgtgaagcccgtggcagtggaggaggacccggaggccgaggttcccacgcacccc
gaggatgcccctcaacctggcaacagcaaggttgaggtcgtgttctggttactgtccatg
ttggctacgagggaccaggaggacactgcacgaacgctactggccatgtccagttcacca
gagagctgtgtggccatgcggcgttcaggctgcctgccactgctgctacagatcctgcat
agcacagaggcagggtctggaggccgcacagggaccccgggggcaccaggtgccaaggac
gctcgcatgcgcgccaatgcagctctgcacaacatcgtcttctcacagccagatcagggc
ctggcacgcaaggagatgcgggtgctgcatgtgctggagcagatccgtgcctactgtgag
acctcctgggactggctgcaggcccgagactcaggagagggaagcagtgcaggaggcacc
cctgtccccattgagcctcagatctgccaggccacctgtgcggtgatgaagctgtccttt
gatgatgagtaccgtcgtgccatgaacgagctaggtgggctgcaggccattgcggaactg
ctgcaagtggattacgagatgcacaagaccacacaggacccactcaaccttgccctgcgc
cgctatgcaggcatgaccctcaccaacctcacttttggagacgtggccaataaggccaca
ttgtgcgcccgccgaggctgtatggaggccattgtagcccagctggcctctgatagcgag
gaactccaccaggtcgtgtccagcatcctccgcaatctgtcatggagagctgacatcaac
agcaagaaagtactgagggaggtgggcagcatgactgccctcatggagtgtgtcttgcgg
gctaccaaggagtccaccctgaagagcgtgctcagtgcattgtggaacctgtctgcacac
agcacagagaataaggcggccatctgccaggtggatggtgctctgggcttcctggtgagc
acgctcacctaccgctgccaagggaactccctggctgtcattgagagtggaggtggtatc
ctgcgcaacgtgtccagcctcatcgccaccagggaagactacaggcaggtgctgcgtgac
cacaactgcctacagacactgctacaacacctcacctcgcacagcctgaccatagtgagc
aatgcgtgtggaacactctggaacctgtctgcccgcagcccccgggatcaggaactgctc
tgggacctaggggcagtgggcatgcttcgaaaccttgttcactccaaacacaagatgatc
gccatgggtagcgctgccgccctgcgcaacctgctggcccaccggcctgccaagtaccag
gtgacagccactgccatctccccgggcacctgtgtgcccagcctgtatgtgcgtaagcag
aaggctctggaggccgaactggacacccggcatctggcacagacgctgggtcacctggag
aaacagggtctggctgaggctgacagtgcttcaaagaaacctttaccaccccttcgccac
ctggatgggctggcaagggactatgcctctgattccggctgctttgatgacgatgatgcg
ccatccctggcagcggctgccactactgcagagcctgccagcccagcgatgctgtccatg
ttcctcagtggcccattcctccagggccaggcgctggcccgtactactgctgcccaccag
ggtggctcagaggctgagaaagaggctggtggggacacagctgtggccatcaaggcaaag
gccaaactggcgctggccgtggcacggattgaccggctggttgaggacatttctgccctc
cacacctcatctgatgacagttttagtctcagctcaggggaccccgggcaggaggcacca
agggagggccaggcccagtcttgttctccatgccggggacacgagggtggccgtcatgag
gtaggtggccgggcccatcctctgctgcggctcaaggctgcccacaccagcctctccaat
gacagtctcaacagcagcagtacaagtgatggttactgtccccgggagcacatgcagccc
tgcccgctggctgctctggctgagcatcgtgaggatcttttgaatgggcagaagcgtccc
agtcggctggacctggacctgcccagaggccgggctgagctgccctcccaggacacagtg
gtgtctgatgcccgtgtgcgaaccatcaaactgtctcccacctatcagcatgttccactg
tttgatggggccactgcagcgggtgtccgacccctcgctggacctggggcctccccgggg
gcttggaagcaggcgtggatgcctgggaacagcccgagcaaggtccccgagaagctggtg
ggctccccgctgcctgtggccagcagggtactgcagaagctagtggcagaggatgggccc
atgtctctttctcgatgtagctctctgtcttcattgtcttccactggccatgctggcccc
agtgagacaggaaatttggatgacagtgattcatctctagaggggttagaggaggctggc
cctgggaagtctgagctggatggagcatggcaggcctcgaggtccacttctctgcccgtg
accatcccagccccacaccagggccacagtcggggtctggggatggaggatgctacctcc
agctcatcagagaactgcgtgcaggagacacccttggtcctcagccgctgtagctccgtg
agttctctgggcagctttgagagccagtccattgcgagctccatccctagtgatccatgc
agcgggctgggcagtggtactgtgagtcccagtgaactgccagatagtcctgggcagacg
atgccacccagccgcagcaagacaccaccggcaccaccgggtcagcctgagaccagccag
ttcagcctacagtgggagagctatgtgaagcgctttttagacattgcggactgtcgggag
cgatgccagccaccctcggagttggatgcaggtagtgtgcgcttcactgtggagaagcct
gatgaaaacttctcctgtgcctccagcctcagcgcactggccctgcatgaactttatgta
caacaggacgtggagctgcgactgaggccaccggcctgcccagagcgtgctgggggcagt
gggggacaccgtcggagggatgaggctgctggccgccttgagggtccaacgtccagtaac
tctcgagctcgtgtggctgctgacaaggagctggagttgctgcgtgagtgtctaggggct
gctgtgcctgcccggctccataaggtgacctctgcattgatgcccggccgccgggcactg
cctgtccctgtgtacatgttagtgcctgccccggcccgggatgatgactcaggtactgac
tcagcagagggcaccccggttaacttttccagtgctgcctcactcagtgatgagacactt
cagggacactccagggaccagccctgtggacctgtggacagacagaaacccataggccaa
gcagcacctgccaggaggagtgctggtcaccggcccaaggcagtgggcactggtaagaac
acagaacaggcccgaggagccagcaggacccgggcaagattggagctgcccctgagccgg
cctttgagtgcacgatccaacagagatggctccagccaggttcggacccatggggatggg
gctctgcagtccctctgcctcactacccccacagaggaggctgtatactgtttttatggc
tctgacgaggagccaccggccacagcaccgccaccaaggcgggcatctgccattccacgg
gctctaaagcaggagaagtccacgaaactagctcctccacccatgagggcccagcccaga
atgattgtggacgagaccccaccatgctactccctgacatcttcggccagttccctcagc
gagcctgaggtccctgagaggccagccagccatctgcaaggccaggagctggtggccacc
aaggacccaggcctgggtggtagacaggatagctttcccagcccacgggctgaggaggaa
ctactgcaaaagtgtatcagctcagcccttccaaggcaccggccacaggtacagggttca
cggcgtcgcaagccacgagctgcccgacagaatgaggtaccccggaaatgctgcgaggag
gtgcctggctccgatccagcctctgatttagacagtgtggagtggaaggccatccaagag
ggcgcaaactccatagtcacttggctgcatcaggcagcagccagggccagcctggaggcc
tcatcagagactgactctgtactgtctttggcatccggtctgtccccaggctcctcttta
cagccttccaaagacaggaaggggcagcaacctggggctgggaccgaagctgtgagtgtc
tgccatccagagaaacaggatacttcctccaccaaggtcagtgggaacccctgctctcct
ggaggctctgagaagccaagaggtgttcatcagaagactgtgacaggggagccagctgtg
ctccggggacggacagtaatttatatgcccagtccagtctcccggtctcagcctaaaggg
gtccccgggccctgtaccaaacctagaaagatggggtcagctggtaccactcagcctgaa
actgccaccaagtcccccagtcctgggcagctgcgttcacggagcctccaccggcctggc
aaaatctctgaactggcagctatgaaccatccaccaaggagtgccacgccgccagctcgc
ctcaccaagaccccatcctccagttcctcccagacctcctctgcctctcagcccctgcct
aggcggtcccctctggctactctcccctcaggatccctgctgggtcctggagagtcccca
gtgcccaagtcaccagcccgggcccttctagctaagcaacacaagactcagaagtcacca
gtgcgaattccattcatgcaaaagccagccaggcgagggccaccaccgctggccaagccg
gccccagagccaggacccagaggccgagcaggggctgaaggggttcccggggtgcgtggt
ggccgcctgggcctggtgcgcatgacctcagcccgttccagtggcagtgagtcctgcacc
cgctcaggtttccgaagacagctgaccttcatcaaagagtccccaggtctcctgcatcgc
cgcagatcagaattgtcatccacaggttccacagtgtccacagcctccatggcccaggtc
tcctcaccctgccatggccagcccacactacctgcagttttcctctgctcctctcgctgt
gacgagctgcgggtgtccccacggcagtccccagggccacagcagtctccgaagtctagg
ccaggtcctaccccacgtgctcccaggcgcaccagctcggagagtccctcacggctgcca
gttcgtaccacccccctgcagcccgagaaagtcaagcggtatgcgtccctgccacacatc
agtgtggcccgcaggcaagatagcacagtccctgtgcctgctgcccgcaccaatgccacc
cgccggggcagtgacagcgaggccaggccactgcccagggtagctgcgccgggcactacc
tggcggcggatccgagatgaagatgtaccctacattctacgtagcacactgcccgccacc
gccctgccactccggggtccatcacctgaggacagcccctcagggacccagcagcgcaag
accagtgatgctgtggttcaaacggaagaggtggtcacccctaagaccaattctagcacg
tcacccagcctggagagcagggatcccccaaaggccccagccaccggccctgttgcaccc
ctgggcagtgatgtggatgggccagtccttgccaagctcccttgctcagtacccttcact
catgaaggcctgagtgtcactgtagggggcttccccatcagcaggcatggctccccaagc
cgggctgcacgcgtatcccccttcaactatgtgcccagtcccatggctgtggccagtaac
tcctcagtggagaaagcccccatgtccactccagtcagcctcctggaatag

DBGET integrated database retrieval system