KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735195
Entry
103735195         CDS       T03372                                 

Gene name
Plcb1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04062  Chemokine signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04621  NOD-like receptor signaling pathway
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
Module
ngi_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103735195 (Plcb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103735195 (Plcb1)
   04310 Wnt signaling pathway
    103735195 (Plcb1)
   04371 Apelin signaling pathway
    103735195 (Plcb1)
   04020 Calcium signaling pathway
    103735195 (Plcb1)
   04070 Phosphatidylinositol signaling system
    103735195 (Plcb1)
   04072 Phospholipase D signaling pathway
    103735195 (Plcb1)
   04071 Sphingolipid signaling pathway
    103735195 (Plcb1)
   04022 cGMP-PKG signaling pathway
    103735195 (Plcb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103735195 (Plcb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103735195 (Plcb1)
   04613 Neutrophil extracellular trap formation
    103735195 (Plcb1)
   04621 NOD-like receptor signaling pathway
    103735195 (Plcb1)
   04062 Chemokine signaling pathway
    103735195 (Plcb1)
  09152 Endocrine system
   04911 Insulin secretion
    103735195 (Plcb1)
   04922 Glucagon signaling pathway
    103735195 (Plcb1)
   04929 GnRH secretion
    103735195 (Plcb1)
   04912 GnRH signaling pathway
    103735195 (Plcb1)
   04915 Estrogen signaling pathway
    103735195 (Plcb1)
   04921 Oxytocin signaling pathway
    103735195 (Plcb1)
   04926 Relaxin signaling pathway
    103735195 (Plcb1)
   04935 Growth hormone synthesis, secretion and action
    103735195 (Plcb1)
   04918 Thyroid hormone synthesis
    103735195 (Plcb1)
   04919 Thyroid hormone signaling pathway
    103735195 (Plcb1)
   04928 Parathyroid hormone synthesis, secretion and action
    103735195 (Plcb1)
   04916 Melanogenesis
    103735195 (Plcb1)
   04924 Renin secretion
    103735195 (Plcb1)
   04925 Aldosterone synthesis and secretion
    103735195 (Plcb1)
   04927 Cortisol synthesis and secretion
    103735195 (Plcb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103735195 (Plcb1)
   04270 Vascular smooth muscle contraction
    103735195 (Plcb1)
  09154 Digestive system
   04970 Salivary secretion
    103735195 (Plcb1)
   04971 Gastric acid secretion
    103735195 (Plcb1)
   04972 Pancreatic secretion
    103735195 (Plcb1)
   04973 Carbohydrate digestion and absorption
    103735195 (Plcb1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103735195 (Plcb1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103735195 (Plcb1)
   04725 Cholinergic synapse
    103735195 (Plcb1)
   04728 Dopaminergic synapse
    103735195 (Plcb1)
   04726 Serotonergic synapse
    103735195 (Plcb1)
   04720 Long-term potentiation
    103735195 (Plcb1)
   04730 Long-term depression
    103735195 (Plcb1)
   04723 Retrograde endocannabinoid signaling
    103735195 (Plcb1)
  09157 Sensory system
   04742 Taste transduction
    103735195 (Plcb1)
   04750 Inflammatory mediator regulation of TRP channels
    103735195 (Plcb1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103735195 (Plcb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735195 (Plcb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103735195 (Plcb1)
   05016 Huntington disease
    103735195 (Plcb1)
   05017 Spinocerebellar ataxia
    103735195 (Plcb1)
   05022 Pathways of neurodegeneration - multiple diseases
    103735195 (Plcb1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103735195 (Plcb1)
   04934 Cushing syndrome
    103735195 (Plcb1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103735195 (Plcb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103735195 (Plcb1)
   05142 Chagas disease
    103735195 (Plcb1)
   05143 African trypanosomiasis
    103735195 (Plcb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103735195 (Plcb1)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103735195 (Plcb1)
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103735195 (Plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103735195 (Plcb1)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 103735195
NCBI-ProteinID: XP_008832575
LinkDB
Position
Un
AA seq 1172 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDTIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNDSLARKGQISVDGFMRYLN
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMDPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTHSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSETPSEARTTPAENGVNHTTSLTPKPPSQAQHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTAKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSAIEQDLAVLDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKETCEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLLEKHKEIRQQILDEKP
KGEGSSSFLSETCLEDPSVPPNFTPPNPQALK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactattgtcacccca
attattttgaggactgatcctcagggatttttcttctactggacagatcaaaataaggag
acggagctgttggatctcagtcttgtcaaggatgccaggtgtgggaagcatgccaaggcc
cccaaggaccccaaattacgtgaacttctggatgtggggaacatcgggcacctggaacat
cgcatgataacagtggtatatgggcctgacctggtgaacatttctcatttgaatcttgtg
gctttccaagaggaagtggccaaggaatggacaaatgaggttttcagcttggcaacaaac
ctgctggcccaaaacatgtccagggacgcgtttctggaaaaagcatacactaaacttaag
ctgcaggtcactccagaagggcgcattcctctcaaaaacatctatcgcttgttttcagca
gaccggaagagagttgaaaccgcattagaggcttgtagtcttccatcttcaaggaatgat
accatacctcaagaggatttcactccagatgtgtacagagttttcctgaacaatctttgt
ccccgacctgaaatcgataacatcttttctgaatttggtgccaaaagcaaaccatacctt
actgttgatcagatgatggattttatcaaccttaagcaacgagatccccggctaaatgaa
atactttatccacctttgaaacaagagcaagtccaagtgttgattgagaagtatgaacct
aatgacagccttgccagaaaagggcagatatcagtggatgggttcatgcgctacctgaac
ggagaagaaaatggcgtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
ccgctgtctcactatttcatcaattcctcacacaacacctacctcacagctggccagttg
gctgggaactcctctgtagagatgtatcgccaagtgcttctgtcgggatgtcgctgtgtg
gaactggactgctggaaggggcggactgcagaggaagaacctgtcatcacccatggattc
accatgacaactgaaatatccttcaaggaagtgatagaagcaattgccgagtgtgcattc
aagacgtcacctttcccaattctcctctcctttgaaaaccatgtggattccccaaagcaa
caagccaagatggcagagtattgccgactcatcttcggcgatgcccttctcatggaccca
ctggaaaaatacccactggaatccggagtgcctcttccaagccctatggatttaatgtat
aagattttggtgaaaaataagaagaaatcacacaagtcgtcagaaggaagtggtaaaaag
aagctttcggagcaagcctccaatacacacagcgactcctccagcgtgttcgagccatca
tctccaggagccggggaagcagatacagagagtgatgatgacgacgacgatgatgactgt
aaaaaatcttcaatggatgagggtacggctgggagcgaggccatggccacggaagagatg
tccaatctggtgaactacattcaacctgtcaagtttgagtcctttgaaatttcaaaaaaa
agaaacaaaagctttgaaatgtcttccttcgtggaaaccaaagggcttgaacaacttacg
aagtctccagtggaatttgtagaatataataaaatgcaactcagtaggatatatcctaaa
ggaacgcgtgtggattcatccaactacatgcctcagctcttctggaatgctggctgtcag
atggtggcactcaatttccagacagtggacctggccatgcaaataaacatggggatgtac
gagtacaacgggaagagcggctacagactaaagccagagttcatgaggaggccggacaag
cattttgatccatttacagaaggcatcgtagatgggatagtggccaacactttgtccgtt
aagatcatttcagggcagtttctttctgataagaaagttgggacttatgtggaggtggat
atgtttggtttgcccgtggacacaaggaggaaagcatttaagaccaagacgtcccaaggg
aatgctgtaaatcctgtctgggaagaagaaccgattgtgttcaagaaggtagtgctgcct
tctctggcctgtttgaggatagcagcatacgaagagggaggcaaatttattggccaccgg
atcttgccagtacaagccattcggccaggctatcactacatctgtctgcggaatgagagg
aaccagcctctgatgctgccagctgtctttgtctacatagaggtgaaagactatgtacca
gacacgtatgcagatgtgatagaagctctgtcaaacccgatccgttatgtgaatctgatg
gagcagagagctaagcaactggccgccctgacactggaagatgaagaggaagtaaagaaa
gaggctgatcctggggaaacaccatcagagactccaagtgaagccaggactactccagca
gaaaatggagtgaatcacaccacatccttgacacccaagccaccttcccaggctcagcac
agtcaaccagctccaggttctgtgaaggcacctgccaaaacagaagaccttatccagagt
gtcttgacagaagtggaagcgcagactattgaagagctcaagcaacagaaatcgtttgtg
aaacttcaaaagaagcattacaaagaaatgaaagacctggttaagagacaccacaagaaa
accaccgacctgatcaaggagcacactgcgaagtacaacgagattcagaatgactacttg
agaagaagggcagccttggaaaagtctgccaaaaaggacagcaagaaaaaatctgaaccc
agcagccctgaccatggttcctccgccattgagcaagaccttgcagtgctggatgcagaa
atgacccagaagttaatcgacttaaaggacaaacagcagcaacagttgcttaatcttcgt
caagaacagtattacagtgagaagtaccagaagcgtgagcatattaaactgcttattcag
aagttgacagatgtggccgaagagtgtcagaacaatcaattaaagaagctcaaggaaacc
tgtgagaaagagaagaaagaactaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaagtccaaggacaaaagccagatggaagaggagaagacagagatgatccgg
tcatacatccaggaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaaagg
caagaaaaacttttggagaaacacaaggagatccgccagcagatcctggatgagaagccc
aagggggaaggttcctcctcattcttgtcggaaacttgccttgaggatccctctgtcccc
cccaactttactccccccaaccctcaagctctcaagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738797
Entry
103738797         CDS       T03372                                 

Gene name
Plcb3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04062  Chemokine signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04621  NOD-like receptor signaling pathway
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
Module
ngi_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103738797 (Plcb3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103738797 (Plcb3)
   04310 Wnt signaling pathway
    103738797 (Plcb3)
   04371 Apelin signaling pathway
    103738797 (Plcb3)
   04020 Calcium signaling pathway
    103738797 (Plcb3)
   04070 Phosphatidylinositol signaling system
    103738797 (Plcb3)
   04072 Phospholipase D signaling pathway
    103738797 (Plcb3)
   04071 Sphingolipid signaling pathway
    103738797 (Plcb3)
   04022 cGMP-PKG signaling pathway
    103738797 (Plcb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103738797 (Plcb3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103738797 (Plcb3)
   04613 Neutrophil extracellular trap formation
    103738797 (Plcb3)
   04621 NOD-like receptor signaling pathway
    103738797 (Plcb3)
   04062 Chemokine signaling pathway
    103738797 (Plcb3)
  09152 Endocrine system
   04911 Insulin secretion
    103738797 (Plcb3)
   04922 Glucagon signaling pathway
    103738797 (Plcb3)
   04929 GnRH secretion
    103738797 (Plcb3)
   04912 GnRH signaling pathway
    103738797 (Plcb3)
   04915 Estrogen signaling pathway
    103738797 (Plcb3)
   04921 Oxytocin signaling pathway
    103738797 (Plcb3)
   04926 Relaxin signaling pathway
    103738797 (Plcb3)
   04935 Growth hormone synthesis, secretion and action
    103738797 (Plcb3)
   04918 Thyroid hormone synthesis
    103738797 (Plcb3)
   04919 Thyroid hormone signaling pathway
    103738797 (Plcb3)
   04928 Parathyroid hormone synthesis, secretion and action
    103738797 (Plcb3)
   04916 Melanogenesis
    103738797 (Plcb3)
   04924 Renin secretion
    103738797 (Plcb3)
   04925 Aldosterone synthesis and secretion
    103738797 (Plcb3)
   04927 Cortisol synthesis and secretion
    103738797 (Plcb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103738797 (Plcb3)
   04270 Vascular smooth muscle contraction
    103738797 (Plcb3)
  09154 Digestive system
   04970 Salivary secretion
    103738797 (Plcb3)
   04971 Gastric acid secretion
    103738797 (Plcb3)
   04972 Pancreatic secretion
    103738797 (Plcb3)
   04973 Carbohydrate digestion and absorption
    103738797 (Plcb3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103738797 (Plcb3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103738797 (Plcb3)
   04725 Cholinergic synapse
    103738797 (Plcb3)
   04728 Dopaminergic synapse
    103738797 (Plcb3)
   04726 Serotonergic synapse
    103738797 (Plcb3)
   04720 Long-term potentiation
    103738797 (Plcb3)
   04730 Long-term depression
    103738797 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    103738797 (Plcb3)
  09157 Sensory system
   04742 Taste transduction
    103738797 (Plcb3)
   04750 Inflammatory mediator regulation of TRP channels
    103738797 (Plcb3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103738797 (Plcb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103738797 (Plcb3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103738797 (Plcb3)
   05016 Huntington disease
    103738797 (Plcb3)
   05017 Spinocerebellar ataxia
    103738797 (Plcb3)
   05022 Pathways of neurodegeneration - multiple diseases
    103738797 (Plcb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103738797 (Plcb3)
   04934 Cushing syndrome
    103738797 (Plcb3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103738797 (Plcb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103738797 (Plcb3)
   05142 Chagas disease
    103738797 (Plcb3)
   05143 African trypanosomiasis
    103738797 (Plcb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103738797 (Plcb3)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103738797 (Plcb3)
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103738797 (Plcb3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103738797 (Plcb3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 103738797
NCBI-ProteinID: XP_008837169
LinkDB
Position
Un
AA seq 1223 aa
MAGARPGVHALQLEPPTVLETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARMPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSSYFINSSHNTYLTAGQLAGTSSVEIYRQVLLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAESAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLSAGVPLPSPQDLMGRILVKNKKRHQPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGHEKPSLEPQKSLGE
DRGPDVLMPTDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVKFK
SFEAARKRNKCFEMSSFVETKAMEQLTKSPLEFVEYNKQQLSRIYPKGTRVDSSNYMPQL
FWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVDGI
VANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEPFDF
PKVVLPTLASLRIAAFEEGGRFVGHRILPVFAIRSGYHYVCLRNEANQPLCLPALLIYTE
ASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTETCQETQSQQLGSQ
PPPNPTPNSLDASPRRPPGPATSPTSTSLSSPGQRDDLIASILSEVIPTPLEELRSHKAL
VKLRSRQERDLRELHKKHQRKAVALTRRLLDGLAQARAESRGRAADVENMKEEEEEARQY
RELQKRQVQSLLELREAQADAETERRLEYLRQAQQRLREVVLDAHATQFKRLKEMNEREK
KELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLV
AGQQQVLQQLMEEEPKLLAQLTQECQEQRVRLPQEIRRCLLGETTEGLQDGSLVACASNG
HAPRSSGHLSGADLESQEENTQL
NT seq 3672 nt   +upstreamnt  +downstreamnt
atggcgggcgccaggccgggcgtccacgcgctgcagttggagccgcccaccgtcttggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaaccta
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacaggacctaacatggag
gtggacacattggacatcagctccatcagggacacacggacaggccgttatgcccgtatg
cctaaggaccccaagattcgagaagtactgggctttgggggccctgatgcccggctggag
gagaagctgatgactgtggtggctgggccagacccagtaaacaccacgttcttgaacttc
atggccgtgcaagatgacacagtcaaggtttggtcagaggagttgttcaagctagctatg
aacatactggctcagaatgcctcccgaaacaccttcctgcggaaagcatacacaaagctg
aagttgcaggtgaaccaggatggacggattccggtcaagaacattctgaagatgttctca
gccgacaagaagcgggtggagactgcgctagagtcctgtggcctcaaattcaaccggagt
gagtccatccggccagatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcgaccggacattgacaagatcctgctggagataggcgccaagggcaaaccttac
ctgacactagaacagctcatggacttcatcaaccagaaacaaagagacccgagactcaac
gaggtgctgtacccacccttgcggccctcacaggccaggctgctcattgaaaagtatgag
cctaaccagcagttcctagagcgagaccagatgtccatggagggcttcagccgctacctg
ggaggggaggagaacggcatcctgcccctggaggccctggatctaagcatggacatgacg
caaccattgagctcgtacttcatcaactcttcacacaacacctatctcactgctgggcag
ctggccgggacgtcgtcggtggagatataccgccaggtgctgctgtggggttgccgctgt
gtggagctggatgtgtggaagggacggccacctgaggaagagcccttcatcacccacggc
ttcaccatgaccactgaggtgcccctgcgtgatgtgctagaggccattgctgagagcgcc
ttcaaaacctcaccctaccctgtcatcctctccttcgagaaccatgtggactcggcaaag
cagcaagccaagatggctgagtactgccgctctatttttggagatgcactgctcatcgac
ccactggacaagtacccgctgtctgcgggcgtccccttacccagcccgcaggacctgatg
ggccgcatcctggtgaagaacaagaagcgacatcaacccagcacaggtgtccctgacagc
tcagtgcgcaagcggcccctggaacagagcaactcggctctgagtgagagttctgctgcc
actgagccctcctcaccccagcttgggtcccccagctctgacagctgcccaggcctgagc
aatggggaagaggtggggcatgagaaacctagcttggagccccagaagtctctgggtgag
gatcgaggccctgatgttctcatgcctactgaccgagaggatgaggaggaagacgaagaa
gaggaggaaacaacagatcccaaaaagcccaccacggatgagggtacagccagcagtgag
gtcaacgccactgaggagatgtcgacacttgtcaactacattgagcctgtcaagttcaag
tcctttgaggctgctcgaaaaagaaacaagtgctttgagatgtcatcctttgtggagacc
aaggctatggagcagctgaccaagagtcccttggaattcgtggaatacaacaagcagcaa
ctcagccgcatttaccccaagggtacccgtgtggactcctccaactacatgccccagctc
ttttggaatgtgggctgccagttagtcgcactcaacttccagaccctggatttaccaatg
cagctcaatgcaggcgtctttgagtacaatgggcgcagtgggtacttgctcaagcctgag
ttcatgcggcggccggataagtcctttgaccccttcacagaggtcattgtggatggcatt
gtggccaacgccttgcgggtcaaggtgatctcggggcagttcctgtctgacaggaaggtg
ggcatctatgtggaggtggacatgttcggtctccccgttgacacaaggcgcaaataccga
actcggacatctcaagggaattccttcaaccctgtgtgggatgaggagccctttgacttc
cccaaggtggtgctacccacactggcttcgcttcgcattgcagcctttgaggaaggtggc
agatttgttgggcaccgaattctccctgtctttgccatccgctcaggataccactatgtt
tgcctgagaaatgaggccaaccagccactctgcctgccagccctgctcatctacactgag
gcctctgattacattccagatgaccaccaggactatgctgaggccctgatcaaccccatc
aagcatgtcagcctgatggaccagcgcgccaagcaactggctgccctcattggggagagt
gaggctcaggccagtacagagacatgtcaggagacccagtctcagcagctggggtcacag
ccgccccctaaccccactccgaactcactggatgcctcccctcggcggcccccaggccct
gccacctcccccaccagcacctccctcagcagcccagggcaacgagacgacctgatcgcc
agcatcctttcagaggtgattcctacccccctggaggaactccgaagccacaaagctctg
gtaaagctccggagccgtcaggagcgagaccttcgggaactgcataagaaacatcagcgg
aaggctgtggccctcactcgccgtctactggatggcctggcccaggccagggctgagagc
aggggcagggctgctgatgtggagaacatgaaagaggaagaggaggaggccagacagtat
cgagagctccagaaacggcaggtgcagagcctcttggagctgagggaagctcaagcagat
gcagagactgagcggaggctggaatacctgagacaggctcagcagcggctcagggaggtt
gttctggatgctcatgccacacaattcaagaggctgaaggaaatgaatgaaagggagaag
aaggagctgcagaagattctggataggaaacgccacaacagtatctcagaggccaagact
agggagaaacataagaaggaggcggaactgacagaaattaatcgacggcacatcaccgag
tcagtcaactccatcagacggctggaggaggcccagaagcaacgacatgaccgcctggtg
gcagggcagcagcaggtccttcagcagctgatggaagaggagcccaagctgctggcccag
ctgacccaggagtgtcaggaacagcgggtgaggctaccccaggagatccgacggtgcctg
ctgggcgagacgacggaggggctacaggatgggtccctggtggcctgtgccagcaatggt
cacgcgccccggagtagtgggcatctgtctggcgccgacttggagagccaggaggagaac
acccaactctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741502
Entry
103741502         CDS       T03372                                 

Gene name
Plcb2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04062  Chemokine signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04621  NOD-like receptor signaling pathway
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
Module
ngi_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103741502 (Plcb2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103741502 (Plcb2)
   04310 Wnt signaling pathway
    103741502 (Plcb2)
   04371 Apelin signaling pathway
    103741502 (Plcb2)
   04020 Calcium signaling pathway
    103741502 (Plcb2)
   04070 Phosphatidylinositol signaling system
    103741502 (Plcb2)
   04072 Phospholipase D signaling pathway
    103741502 (Plcb2)
   04071 Sphingolipid signaling pathway
    103741502 (Plcb2)
   04022 cGMP-PKG signaling pathway
    103741502 (Plcb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103741502 (Plcb2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103741502 (Plcb2)
   04613 Neutrophil extracellular trap formation
    103741502 (Plcb2)
   04621 NOD-like receptor signaling pathway
    103741502 (Plcb2)
   04062 Chemokine signaling pathway
    103741502 (Plcb2)
  09152 Endocrine system
   04911 Insulin secretion
    103741502 (Plcb2)
   04922 Glucagon signaling pathway
    103741502 (Plcb2)
   04929 GnRH secretion
    103741502 (Plcb2)
   04912 GnRH signaling pathway
    103741502 (Plcb2)
   04915 Estrogen signaling pathway
    103741502 (Plcb2)
   04921 Oxytocin signaling pathway
    103741502 (Plcb2)
   04926 Relaxin signaling pathway
    103741502 (Plcb2)
   04935 Growth hormone synthesis, secretion and action
    103741502 (Plcb2)
   04918 Thyroid hormone synthesis
    103741502 (Plcb2)
   04919 Thyroid hormone signaling pathway
    103741502 (Plcb2)
   04928 Parathyroid hormone synthesis, secretion and action
    103741502 (Plcb2)
   04916 Melanogenesis
    103741502 (Plcb2)
   04924 Renin secretion
    103741502 (Plcb2)
   04925 Aldosterone synthesis and secretion
    103741502 (Plcb2)
   04927 Cortisol synthesis and secretion
    103741502 (Plcb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103741502 (Plcb2)
   04270 Vascular smooth muscle contraction
    103741502 (Plcb2)
  09154 Digestive system
   04970 Salivary secretion
    103741502 (Plcb2)
   04971 Gastric acid secretion
    103741502 (Plcb2)
   04972 Pancreatic secretion
    103741502 (Plcb2)
   04973 Carbohydrate digestion and absorption
    103741502 (Plcb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103741502 (Plcb2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103741502 (Plcb2)
   04725 Cholinergic synapse
    103741502 (Plcb2)
   04728 Dopaminergic synapse
    103741502 (Plcb2)
   04726 Serotonergic synapse
    103741502 (Plcb2)
   04720 Long-term potentiation
    103741502 (Plcb2)
   04730 Long-term depression
    103741502 (Plcb2)
   04723 Retrograde endocannabinoid signaling
    103741502 (Plcb2)
  09157 Sensory system
   04742 Taste transduction
    103741502 (Plcb2)
   04750 Inflammatory mediator regulation of TRP channels
    103741502 (Plcb2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103741502 (Plcb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741502 (Plcb2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103741502 (Plcb2)
   05016 Huntington disease
    103741502 (Plcb2)
   05017 Spinocerebellar ataxia
    103741502 (Plcb2)
   05022 Pathways of neurodegeneration - multiple diseases
    103741502 (Plcb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103741502 (Plcb2)
   04934 Cushing syndrome
    103741502 (Plcb2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103741502 (Plcb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103741502 (Plcb2)
   05142 Chagas disease
    103741502 (Plcb2)
   05143 African trypanosomiasis
    103741502 (Plcb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103741502 (Plcb2)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103741502 (Plcb2)
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103741502 (Plcb2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103741502 (Plcb2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 103741502
NCBI-ProteinID: XP_008840540
LinkDB
Position
Un
AA seq 1181 aa
MSLLNPVLLPPKVKEYLSQGERFIKWDDETSIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITNIRDTRFGKFAKMPKSQKLREVFNMDFPDDHFLLKALTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDVLALAKHPMTVNASRSTFLDKILVKLKMQRNPEGKIPVKNFFQMFPADRKR
VEAALSACHLAKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPEQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLSQNALLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDILFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGETLLTEPLEKFPLKAGIPLPSPEDLRGKILIKNKKNQFSGPEAPSKKPGGE
AEGSCSPNASLGEDTVWAAEDRAEVEEEEVEEEEEEESGSLDEEEMKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKASDLLSKASVQFVDYNKRQM
SRVYPKGTRMDSSNYMPQMFWNVGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEF
MRRLDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPTTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLRSESNIPLTMPALFVFLEMKDYIPDTWADLTVALANPIKYFSAHDKKSVKLKEATGSL
LEKPFPLGSPATSQANGSSVPAGNGSAAPGTKAKEEARKEVAEPQTASLEELREMKGVVK
LQRRHEKELRELERRGARRREELLQRGAAQLAELGPPGTGCKLRPGKGSRKKRTLPCEEP
TAAAMGEFPEGTDSRLRELKDRLEQELQQHWEEQHRSILKRKEQHVAEQTAKMMEVAREK
QSAELKTFKETSEIDTKEMKKKLEAKRLERIQAMTKVTTDKVAQERLKREINNSHIQEVV
QAVKQMTETLERHQEKLEEKQAACLKQIREMEKQFQQEALAEYEARMKGLETEVKESVKA
CFRTCFPSEVQDKSDRTCDTSRELCWQDPLTDKADTQESRL
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcttgctgccccctaaggtgaaggagtatctgagccaaggc
gagcgcttcatcaagtgggatgatgaaacttcaatagcctccccagtcatccttcgtgtg
gatcccaagggatattacctatactggacatatcagagtaaggagatggagtttctggat
atcactaacatccgagacacccgctttggcaagtttgccaagatgcccaagagccagaaa
ctccgtgaggtcttcaacatggattttccagatgaccactttctgctgaaggcactcacg
gttgtgtccggccctgacatggtggaccttaccttccacaactttgtctcttacaaggaa
aacgtgggcaaggattgggctgaggatgtactggccctggccaagcacccgatgacagtc
aatgcttcccgcagcactttcctagacaagatcctggtgaagctcaagatgcagcgtaat
cctgaagggaagattcctgtgaagaattttttccagatgtttcctgctgaccgcaaacgt
gtagaagctgccctcagtgcttgtcaccttgcaaaaggcaagaatgatgctatcaatcct
gaggacttcccagaatccgtatacaagagcttcctaatgagcctctgtcctcggccagaa
atcgatgagatcttcacttcttaccatgctaaagccaaaccatacatgaccaaggaacac
ctgaccaaattcatcaatcagaagcagcgggactctcgactcaactccttgctgttccca
ccagcccgacctgagcaggtgcagggccttatcgacaagtatgagcccagcggcatcaat
gtacagaggggtcaattgtcacccgagggcatggtctggtttctctgcggaccagagaac
agtgtgctgtcccagaatgcactgttgcttcaccatgacatgacacagccacttaatcac
tatttcattaactcctcacacaacacctacttgacagctggccagttttcaggtctttct
tccgcggagatgtaccgccaggtactgctgtctggctgccgttgtgtggaactagactgt
tggaagggaaagcccccagatgaggagcccattattacccacggtttcaccatgaccaca
gacatcttattcaaggaagcaatcgaagccattgcagaaagtgcctttaagacctccccc
tatcctgtcatcttgtcatttgaaaaccatgtggactcaccccgccaacaggctaagatg
gctgaatactgccggaccatgtttggagagaccctgcttacagagcccctggaaaagttt
cctctgaaagctggcatccctctgcccagccctgaggacctccggggcaagatcctcatc
aagaataagaagaaccagttttctggtccagaagctcccagcaagaagcctggtggggag
gctgagggtagctgctcgcccaatgcctccttgggggaggacacagtgtgggctgctgag
gacagggctgaggtagaggaggaggaggtggaagaagaggaagaagaggagtcaggaagc
ctggatgaagaagagatgaagaagatgcagtcggatgagggcacagcaggcctggaggtg
actgcttatgaggaaatgtccagccttgtcaattatatccagcctaccaagttcatctcc
ttcgagttctctgcacagaagaaccgaagttatgtcatctcctccttcacggagctcaag
gcctctgacctgctctccaaagcctcggtgcagtttgtggactacaacaagcgccagatg
agtcgtgtgtaccccaagggcacacgtatggactcctccaactacatgccccagatgttc
tggaatgttggatgccagatggttgctctcaacttccagacaatggacctgcctatgcag
cagaacatggccctgttcgagttcaatgggcagagtggctacctcctcaagcatgagttc
atgcgccggctggacaaacagttcaaccctttctcagtggaccgcatcgatgtggtggta
gccaccaccctttccattacggtgatctctgggcagttcctgtctgaacgcagtgtacgc
acctatgtggaagtggaactgtttggtctcccaggggaccccaagaggcgttatcgcacc
aaactgtcacctacaactaactccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttgatgcctgagctagcctccctcagggtggctgtgatggaggaaggcaac
aaatttcttggacaccgaatcatccccattaatgctctaaattctggataccaccaccta
tgcctgcgtagtgagagcaacatacccctcactatgcctgcactcttcgtcttcctggag
atgaaggactatatacctgacacctgggcagatctcactgtggctctcgccaaccccatc
aaatacttcagtgctcatgataagaaatctgtgaagctcaaggaggccacaggaagtctg
cttgagaagcccttcccattggggagtcctgctaccagccaggccaatgggtcatctgtc
ccagcaggcaacgggtcagcagcacctggaaccaaagccaaggaggaagcccggaaagaa
gtggcagagccacagaccgccagtctggaggagctgcgggagatgaagggggtggtgaag
ctgcagaggcggcatgagaaggagcttcgggagctggagcggcggggagcccggcgccgg
gaggaactgctgcagcgaggtgcggcacagctggccgagctcgggccgccaggcacgggc
tgcaagcttcgcccaggcaagggctcccgcaagaagagaaccttgccctgcgaggagccc
actgcagctgcaatgggcgagttccccgaggggacggactcacggctgcgggagttgaag
gacaggctggaacaggagttacagcagcactgggaggagcagcaccggagtattctcaag
cgcaaggagcagcatgtagccgagcaaaccgccaagatgatggaggtagccagagagaaa
cagtctgcagagctcaagaccttcaaggagacctcagaaattgacaccaaagaaatgaag
aaaaaactggaggctaagaggttggagcggattcaggccatgaccaaagtcaccacagac
aaggtggcccaggaaaggctgaagagagagattaacaactcccacattcaggaagtggtg
caggctgtcaagcagatgacagagacactggaacgacaccaggaaaagctggaagagaag
caggcagcctgcctgaagcagatccgagagatggaaaagcagttccagcaggaggctctg
gctgagtatgaagccaggatgaagggcctagagactgaggtgaaggagtcggtgaaggcc
tgtttcaggacctgcttcccttctgaggtacaggacaagtctgacaggacctgtgatacc
tccagagagttgtgctggcaggatccactcacagacaaggcagacacccaggagagccgc
ctctga

DBGET integrated database retrieval system