KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735486
Entry
103735486         CDS       T03372                                 

Gene name
Tymp
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00240  Pyrimidine metabolism
ngi00983  Drug metabolism - other enzymes
ngi01100  Metabolic pathways
ngi05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    103735486 (Tymp)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103735486 (Tymp)
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    103735486 (Tymp)
Enzymes [BR:ngi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     103735486 (Tymp)
SSDB
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Other DBs
NCBI-GeneID: 103735486
NCBI-ProteinID: XP_008832993
LinkDB
Position
Un
AA seq 488 aa
MAASGTPPPSTPEAAGALSGKESGEPKQLPELIRMKRDGGRLSEADIRGFVQAVVDGSAQ
DTQIGAMLMAIRLQGMDLEETSALTQALAKSGQQLEWPEAWHQQLVDKHSTGGVGDKVSL
VLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFSVIQSPQQMLLLLEQVGCCIVGQ
SEKLVPADGILYAARDVTATVDSVSLITASILSKKAVEGLSTLVVDVKFGGAAVFPDQEQ
ARELAKTLVNVGVSLGLRVAAALTTMDNPLGRTVGHVLEVEEALLCLDGAGPPDLRDMVI
RLGGALLWLSGQAETQDQGDARVAAALDDGSALGRFQRMLAAQGVDPGLARALCSGSPTQ
RRQLLPHARKQEELLAPSDATPQRPPSPAGTVERVQALPLALVLHELGAGRSRAGQHILP
GVGAELLVNVGQRLRCGTPWLRVHLDGPSLSGPQRRALQGALVLSDRAPFAAPSPFAELL
LPPTTSRP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcagcctcagggacaccacccccatccactccagaagcagctggtgccctctcaggg
aaagagagtggggagcccaaacagctcccagagctgatccgcatgaagcgagatggaggt
cgcctgagcgaagcagacattaggggctttgtgcaggctgtggtggatggaagtgcacag
gacacacaaatcggagccatgctcatggccatccggctgcagggcatggacctggaggag
acatctgcactgactcaggctctggccaaatctggacagcagttggagtggccggaggcc
tggcaccagcaacttgtggataaacactccacaggcggcgtgggtgacaaggtcagcctg
gtcctggcacctgccctggctgcctgtggctgcaaggtgccaatgatcagtggacgtggt
ttgggacacacagggggtacattggataagctggagtctattcctgggttcagtgtcatc
cagagcccacaacagatgctgctgctactggagcaagtgggctgctgcattgtgggccag
agtgagaaactagttcctgctgatggaatcctgtatgctgcacgagatgtaacagctact
gtggacagtgtgtcactcattacagcctccatcctcagtaagaaggccgtggagggactg
tccactctggtggtggacgttaaatttgggggggctgcagtcttcccagatcaggagcag
gctcgagagctggcaaagacgttggttaatgtaggagtaagcctggggctgcgggtggcc
gcagcgctgaccaccatggacaaccccctgggccgcaccgtgggccacgtgctggaggtg
gaagaagcgttgctttgcctggatggtgcggggccgccagacctgcgggacatggtcatt
aggctaggaggcgccctgctttggctcagcggacaagcagagacccaagaccagggcgac
gcccgggtggctgcagccttggacgacggctcagcgctaggtcgcttccagcggatgctt
gcggcgcagggcgtggaccccggcctggctcgagcactgtgctccggaagtcccacgcaa
cgccgccagctactgccccacgcccggaagcaagaagagctgctcgcaccctcggacgca
actccccaacgcccgccctctcccgcaggcactgtggagcgcgtccaggcgctgccactc
gccctggtgttacacgagctcggggccggacgaagccgagcgggtcagcatatcctgccc
ggcgtgggcgccgagctgctggtcaacgtgggtcagcggctgcgctgcgggacgccctgg
ctccgcgtgcacctggacggcccgtcgctcagcggcccccagcgccgtgccttgcagggg
gcgctcgtgctgtcggaccgcgcgcctttcgcggctccctcgcccttcgcggagctgctc
ttgcctccgaccacctcgcgaccctga

DBGET integrated database retrieval system