KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735491Help
Entry
103735491         CDS       T03372                                 

Gene name
Cpt1b
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00071  Fatty acid degradation
ngi01212  Fatty acid metabolism
ngi03320  PPAR signaling pathway
ngi04152  AMPK signaling pathway
ngi04714  Thermogenesis
ngi04920  Adipocytokine signaling pathway
ngi04922  Glucagon signaling pathway
ngi04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103735491 (Cpt1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103735491 (Cpt1b)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103735491 (Cpt1b)
   04920 Adipocytokine signaling pathway
    103735491 (Cpt1b)
   03320 PPAR signaling pathway
    103735491 (Cpt1b)
  09159 Environmental adaptation
   04714 Thermogenesis
    103735491 (Cpt1b)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103735491 (Cpt1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ngi03029]
    103735491 (Cpt1b)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103735491 (Cpt1b)
Mitochondrial biogenesis [BR:ngi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103735491 (Cpt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 103735491
NCBI-ProteinID: XP_008833004
LinkDB All DBs
Position
Un
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALKHIYQSGINSWKKRLIRLKNGILRGVYPGSPT
SWLAVIMATVGSSYCKVDISMGLVCYIQQCLPERYGPYGTPQTQALLSMVVFSTGVWVTG
IFLFRQTLKMLLSYHGWMFEMHSKTSRSTKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIHRYLDSVRPLLDDEEYYRMETLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRSRSPLMVNSNYYAMDFVLIKNTDVQAARLGNAVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDVLQHLSDSRHVAVYHKGRFFKVWLYEGSRLLKPRDL
EMQFQRILDDSSLPQPGEEKLAALTAGGRVEWAHARQTFFNSGKNKTALETIERAAFFVA
LDEESHCYSPDDEASLSLYGKALLHGNSYNRWFDKSFTLISFKNGLLGLNTEHAWADAPI
IGHLWEFVLGTDTFHLGYTETGHCVGEPNTMLAPPQRLQWDIPEQCQAAIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMKGSHTKEDLQDLFRKASKKHQNMYRLAMTGAGIDRHLFCL
YVVSKYLGVSSPFLAEVLSEPWSLSTSQIPQSQIRMFDPNQYPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHVSCKFSSSETNAQRFGNHIRQALLDIADLFKISKTDS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcacaccaggcggtagccttccagttcactgtgaccccagacggggttgac
ttccggctcagtcgggaggccctgaaacacatctaccagtcaggaatcaattcctggaag
aaacgcctgattcgcctcaagaatggcatccttaggggtgtgtaccctggcagccccacc
agctggctagctgtcatcatggcaacagtgggttcctcctactgcaaggtggacatctcc
atgggactggtctgttatatccagcaatgcctccctgagaggtatggcccctatgggacc
ccacagacgcaggcacttctcagcatggttgtcttctccacgggggtctgggtgacaggc
atcttcttattccgacaaaccctgaagatgctgctttcctaccacggatggatgtttgag
atgcacagcaagaccagccgtagcaccaagatatgggctatctgtgttcgccttctgtcc
agtcgacgtcccatgctctacagcttccagacatctttgcctaagcttcctgtacccagt
gtgccggctacaattcatcggtacctggattctgtgcggcccttattggatgatgaagaa
tattaccgcatggagacactggccaaagaattccaggacaagactgcccccaggctgcag
aaatacctggtcctcaagtcatggtgggcaactaactatgtaagtgactggtgggaagaa
tacgtctacctccgaagcaggagccccctcatggtgaacagcaactattatgccatggat
tttgtgcttatcaagaacacagatgtgcaggcagcacgtctgggaaatgctgttcatgcc
atgatcatgtatcgccgcaaactagaccgtgaagaaatcaagcctgtaatggcactaggc
atggtgcccatgtgctcctaccagatggagaggatgttcaataccacacgcatcccgggc
aaggagacagatgtgctacagcacctctcagacagtaggcatgtggctgtttaccacaag
ggccgcttcttcaaggtgtggctctatgaaggctcccgcctactcaagcctcgggacctg
gagatgcagttccaaaggatcctggatgactcttccctaccgcagcctggggaagagaaa
ctggctgccctcactgcagggggaagggtggaatgggcacatgcacgtcagaccttcttc
aactctggcaagaataagactgctctggagaccattgagcgtgctgctttctttgtggct
ctggatgaggagtcccattgctacagccctgatgatgaggctagcctcagcctctacggc
aaggccttgctacatggcaatagctacaaccggtggttcgacaaatctttcactcttatt
tccttcaagaatggcctattgggcctcaacacagaacatgcatgggcagatgcccccatc
attgggcacctctgggagtttgtactgggcactgatacctttcacctgggctacacagag
actggacactgcgtgggtgagccaaacactatgctggcacctcctcagcggctgcagtgg
gacattcctgagcagtgccaggcagccattgagagttcctaccaagtggccaaagcactt
gcagatgatgtggagttatactgcttccaattcttgccctttggcaaaggcctcatcaaa
aagtgtcggaccagccctgatgcctttgtgcagattgccctgcagctggctcacttccgg
gacaaaggcaagttctgcctgacctatgaagcctcaatgaccagaatgttccgagaggga
cggactgagactgtgcgttcctgtaccagtgagtcaacagcctttgtgcaggccatgatg
aaggggtcccatacgaaagaagacctccaagatctgttccggaaggcttctaaaaagcac
cagaacatgtaccggctggccatgacaggggctgggattgacaggcacctcttctgcctt
tacgtggtctccaagtacctaggggttagctccccttttctggctgaggtgctctccgaa
ccctggagcctctctaccagccagatccctcagtcccagatccgcatgtttgacccaaac
cagtacccgaatcaccttggtgctggaggtggctttggccctgtggcagatgatggctat
ggggtttcctacatgattgcaggtgaaaacactatcttcttccatgtttcctgcaagttc
tcaagttcagagacaaatgcccagcgctttgggaatcacatccgccaagcactgctggac
atcgctgatcttttcaaaatttccaagactgacagctga

DBGET integrated database retrieval system