KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735893
Entry
103735893         CDS       T03372                                 

Gene name
Stat5b
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04012  ErbB signaling pathway
ngi04062  Chemokine signaling pathway
ngi04217  Necroptosis
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04917  Prolactin signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05161  Hepatitis B
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103735893 (Stat5b)
   04630 JAK-STAT signaling pathway
    103735893 (Stat5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103735893 (Stat5b)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103735893 (Stat5b)
   04659 Th17 cell differentiation
    103735893 (Stat5b)
   04062 Chemokine signaling pathway
    103735893 (Stat5b)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103735893 (Stat5b)
   04935 Growth hormone synthesis, secretion and action
    103735893 (Stat5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735893 (Stat5b)
   05203 Viral carcinogenesis
    103735893 (Stat5b)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103735893 (Stat5b)
   05220 Chronic myeloid leukemia
    103735893 (Stat5b)
   05223 Non-small cell lung cancer
    103735893 (Stat5b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103735893 (Stat5b)
   05161 Hepatitis B
    103735893 (Stat5b)
   05162 Measles
    103735893 (Stat5b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103735893 (Stat5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103735893 (Stat5b)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103735893 (Stat5b)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 103735893
NCBI-ProteinID: XP_008833513
LinkDB
Position
Un
AA seq 786 aa
MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLTDTMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERMSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
NSTHLEDYNNMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPTTAKAVDGYVKPQIKQVVPEFAGASTDTGA
SATYMDQAPSPAVCPQTHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDGQW
IPHAQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcgatgtggatacaagctcagcagctccagggagatgcccttcaccagatgcaagcc
ttgtatggccagcatttccccattgaggtgcgccattatttatcccagtggattgaaagc
caagcctgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggtctggtgcaggagctgcagaagaaggcagagcaccaggtgggggaagatggg
tttttgctgaagatcaagctggggcactatgccacgcagctccagaacacctatgaccgc
tgccccatggagctggttcgctgcatccggcacattctgtacaatgaacagaggcttgtc
cgagaagccaacaatggcagctccccagctggaagtctcactgacaccatgtcccagaag
caccttcagatcaaccagacatttgaggagctgcgtctggtcacacaggacacagagaat
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtaccaggagagccta
cgcatccaagctcagtttgcccagctggcccaactgaacccccaggagcgcatgagccga
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgggaggcccag
acgctacagcagtaccgcgtggagctggctgagaagcaccagaagaccctgcagctgctg
cggaagcaacagaccatcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggctggaaacgggggtccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggcggaacacctctgc
cagcagctgcccatccctggtcccgttgaggagatgctggccgaggtcaacgccaccatc
acagacatcatctcagccctggtcaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggtgggaagctg
aatgtgcacatgaaccccccgcaggtgaaggccaccatcatcagtgagcagcaggctaag
tccctgctcaagaacgagaacacccgcaatgattacagtggcgagatcctgaacaactgc
tgcgttatggagtaccaccaggccaccggcaccctcagtgcccacttcagaaacatgtcc
ctgaaacgaattaagagatctgaccgccgtggcgcagagtctgtgacagaagaaaaattc
acaatcctgttcgactcacagttcagtgttggtggaaatgagctggtctttcaagttaag
accctgtccctcccggtggtggtgattgttcatggcagccaggacaacaatgcgacggcc
acagtcctctgggacaatgcttttgcagaacctggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaagcgcttaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaaccttgtgttcctggcacagaaactgttcaacagc
aatagcacccacctcgaggactacaacaacatgtccgtgtcctggtcccagttcaacagg
gagaatttgccaggacggaattatactttctggcagtggtttgatggtgtgatggaagtg
ttaaaaaaacatctcaagcctcactggaatgatggggccatcttgggttttgtgaacaag
caacaggcccatgacctactcattaacaagccagacggaactttcctactgaggttcagc
gattcagaaatcggaggcatcaccattgcttggaagtttgactctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccatccggtccctggctgaccgcttg
ggggacttgagttaccttatatacgtgtttcctgatcggccaaaagatgaagtgtactcc
aagtattacacgcccgttccctgcgagcccaccactgctaaagcagttgacggttacgtg
aaaccacagatcaagcaagtggtccctgagtttgctggtgcatccacagatactggagcc
agtgccacctacatggaccaggccccctccccagcagtgtgtccccagactcactacaac
atgtacccacagaaccccgactctgtccttgacaccgatggggacttcgatctagaagac
acgatggatgtggctcggcgtgtggaagagctcttgggccggcccatggatggtcagtgg
atccctcacgcacagtcatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735895
Entry
103735895         CDS       T03372                                 

Gene name
Stat5a
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04012  ErbB signaling pathway
ngi04217  Necroptosis
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04917  Prolactin signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05161  Hepatitis B
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103735895 (Stat5a)
   04630 JAK-STAT signaling pathway
    103735895 (Stat5a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103735895 (Stat5a)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103735895 (Stat5a)
   04659 Th17 cell differentiation
    103735895 (Stat5a)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103735895 (Stat5a)
   04935 Growth hormone synthesis, secretion and action
    103735895 (Stat5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735895 (Stat5a)
   05203 Viral carcinogenesis
    103735895 (Stat5a)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103735895 (Stat5a)
   05220 Chronic myeloid leukemia
    103735895 (Stat5a)
   05223 Non-small cell lung cancer
    103735895 (Stat5a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103735895 (Stat5a)
   05161 Hepatitis B
    103735895 (Stat5a)
   05162 Measles
    103735895 (Stat5a)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103735895 (Stat5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103735895 (Stat5a)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103735895 (Stat5a)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 103735895
NCBI-ProteinID: XP_008833514
LinkDB
Position
Un
AA seq 793 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRGQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGNYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGVLVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERMSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
NSTHLEDYNNMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLTYLNYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGSSATYM
DQAPSPVVCSQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSP
PAGLFTSTRSSLS
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggcgggctggattcaggcccagcagctgcagggagatgccctccgccagatgcaagtg
ctatacggacagcacttccccatcgaggtcagacactacctggctcagtggatagagagc
cagccatgggatgccattgacctggataatccccaggaccgaggccaggccacccagctc
ctggagggtctggtgcaggagctgcagaagaaggcagagcaccaggtgggggaagatggg
tttttgctgaagatcaagctggggaactatgcgacgcagctccagaacacatatgaccgc
tgtcccatggagctggttcgctgtatcaggcacattctgtacaatgaacaaaggctggtc
cgagaagccaacaactgtagctcacctgctggtgtcctggttgatgccatgtcccagaag
caccttcagatcaaccagacatttgaggagctgcgtctggtcacacaggacacagagaat
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtaccaggagagccta
cgcatccaagctcagtttgcccagctggcccaactgaacccccaggagcgcatgagccga
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgggaggcccag
acgctacagcagtaccgcgtggagctggctgagaagcaccagaagaccctgcagctgctg
cggaagcaacagaccatcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggctggaaacgggggtccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggcggaacacctctgc
cagcagctgcccatccctggtcccgttgaggagatgctggccgaggtcaacgccaccatc
acagacatcatctcagccctggtcaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggtgggaagctg
aatgtgcacatgaaccccccgcaggtgaaggccaccatcatcagtgagcagcaggctaag
tccctgctcaagaacgagaacacccgcaatgaatgcagtggggagatcctaaacaactgc
tgcgtcatggagtaccaccaggccaccggcaccctcagcgcccatttcagaaacatgtca
ttgaaaagaatcaagcgagctgacaggcgaggtgcagagtcggtgacagaggagaagttc
acggtcctgtttgaatctcagttcagtgttggcagcaatgagcttgtattccaggtgaag
accctgtccctgcctgtggttgtcatcgtccacggcagccaggaccataatgccactgcc
actgttctatgggacaatgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaagcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaaccttgtgttcctggcacagaaactgttcaacagc
aatagcacccacctcgaggactacaacaacatgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggttcgacggggtgatggaggtg
ctaaagaagcatcataagccacactggaatgatggggccatcttaggttttgtgaataag
caacaggcccacgatctgctcatcaacaagccagatgggaccttcctactgcggttcagc
gactcagaaattggaggcatcaccattgcctggaagtttgactctccggaccgcaacctg
tggaacttgaagccattcactacgagggatttctccatccggtccctggccgacaggctg
ggggatctgacctacctcaactacgtgttcccagaccgtcccaaggatgaggtcttttct
aagtactacactcctgtgcttgctaaagcagttgacggatatgtgaagccacagatcaag
caagtggtccctgagttcgtcaatgcatctgcagatgctgggtccagcgccacatacatg
gaccaggctccctccccagtggtgtgctcccaggctcactacaacatgtatcctcagaac
cctgaccctgtcctcgaccaagatggagaatttgacctggatgagactatggatgttgcc
aggcatgtggaagaacttttacgacggcccatggacagtcttgactcccgcctctcccca
cctgctggtctcttcacttccaccagaagctccctgtcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735896
Entry
103735896         CDS       T03372                                 

Gene name
Stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04217  Necroptosis
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04931  Insulin resistance
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05145  Toxoplasmosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103735896 (Stat3)
   04066 HIF-1 signaling pathway
    103735896 (Stat3)
   04068 FoxO signaling pathway
    103735896 (Stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103735896 (Stat3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103735896 (Stat3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103735896 (Stat3)
   04062 Chemokine signaling pathway
    103735896 (Stat3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103735896 (Stat3)
   04917 Prolactin signaling pathway
    103735896 (Stat3)
   04935 Growth hormone synthesis, secretion and action
    103735896 (Stat3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735896 (Stat3)
   05206 MicroRNAs in cancer
    103735896 (Stat3)
   05205 Proteoglycans in cancer
    103735896 (Stat3)
   05203 Viral carcinogenesis
    103735896 (Stat3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103735896 (Stat3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103735896 (Stat3)
   05221 Acute myeloid leukemia
    103735896 (Stat3)
   05223 Non-small cell lung cancer
    103735896 (Stat3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103735896 (Stat3)
   05160 Hepatitis C
    103735896 (Stat3)
   05171 Coronavirus disease - COVID-19
    103735896 (Stat3)
   05162 Measles
    103735896 (Stat3)
   05163 Human cytomegalovirus infection
    103735896 (Stat3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103735896 (Stat3)
   05169 Epstein-Barr virus infection
    103735896 (Stat3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103735896 (Stat3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103735896 (Stat3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103735896 (Stat3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103735896 (Stat3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103735896 (Stat3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103735896 (Stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103735896 (Stat3)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103735896 (Stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 Syntaxin-6_N DUF4795 Fib_alpha
Other DBs
NCBI-GeneID: 103735896
NCBI-ProteinID: XP_008833515
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctcgacacacggtacctggagcaacttcatcag
ctgtacagtgacagcttccccatggagctacggcagttcctggcaccttggattgagagt
caagattgggcatatgcagccagcaaagagtcacatgccacgctggtatttcataacctc
ctgggtgagattgaccagcaatacagccgcttcctgcaagagtccaatgtcctctatcag
cacaacctgcgaagaatcaagcagttcctccagagcaggtatcttgagaaaccaatggaa
attgcccggattgtggcccggtgcctgtgggaagagtcccgcctcctccagacggcagcc
actgcagcccagcaagggggtcaggccaaccaccctacagctgctgtggtgacggagaag
cagcagatgctggaacagcaccttcaggatgttcggaaacgtgtgcaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtctgtgaccaggcagaagatg
cagcagctggaacagatgctcacagcgctggaccagatgcggagaagcattgtgagtgag
ttggcggggcttttgtcagcgatggagtatgttcagaaaacgcttacagatgaagagctg
gctgactggaagaggcggcaacagattgcctgcattggcggccctcccaacatctgcctg
gatcgtctagaaaactggataacctcattagcagaatctcaacttcagacccgccaacaa
attaagaaactggaggaattgcagcaaaaagtttcctataaaggggaccctattgtacaa
caccggccaatgctggaggagagaattgtggagctattcagaaacttaatgaaaagtgcc
ttcgtggttgagcggcagccctgcatgcccatgcaccctgaccggcccttagtcatcaag
actggtgtccagtttaccactaaagtcaggttgctggtcaaatttcctgagttgaattac
cagcttaaaattaaagtgtgcattgacaaagactccggggacgttgctgccctcagagga
tcccggaaatttaacattctgggcacaaacacaaaagtgatgaatatggaagagtccaac
aatggcagcctgtctgcggaattcaagcacttgaccctgagggagcagagatgtgggaat
gggggccgtgccaattgtgatgcttccttgattgtgactgaggagctgcacctgatcaca
tttgagactgaggtctaccaccaaggcctcaagatcgacctagagacccattccttgcca
gttgtggtgatttccaacatctgtcagatgccaaatgcctgggcatcgatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagcctccaattggaacc
tgggatcaagtagctgaggtgctgagctggcagttctcctccaccacaaaaagagggctg
agcatcgagcagctgactacgctggctgagaagctcttaggacctggcgtgaactactca
gggtgtcaaatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaatatcattgaccttgtgaagaagtacatcctggccctttgg
aatgaagggtacatcatgggctttatcagcaaggagcgggagcgggccatcctgagcacc
aagcccccgggtaccttcctactgagattcagcgagagcagcaaagaaggaggggtcact
ttcacttgggtggagaaggacatcagtggcaagacccagatccagtcggtggagccgtac
acaaagcaacagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgctacaaacatcctggtgtctcctctggtctatctctaccctgacattcctaaggag
gaagcatttggaaagtattgtcggccagagagccaggagcatcctgaagctgacccaggt
agtgctgccccttacctgaagaccaagttcatctgtgtgactccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgagccctcagcaggaggacagtttgagtcactcacgtttgacatggag
ctgacctcggagtgtgctacctcccccatgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736155
Entry
103736155         CDS       T03372                                 

Gene name
Stat4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04217  Necroptosis
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi05161  Hepatitis B
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736155 (Stat4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103736155 (Stat4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103736155 (Stat4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736155 (Stat4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103736155 (Stat4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103736155 (Stat4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103736155 (Stat4)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103736155 (Stat4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 CRC_subunit DUF6353 NPV_P10
Other DBs
NCBI-GeneID: 103736155
NCBI-ProteinID: XP_008833831
LinkDB
Position
Un
AA seq 748 aa
MTQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEVASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSTLMSQEVLTLQEMLNSLDFKRKEALSKVTQIVNETDLLMNSMLTEELQDWKR
RQQIACIGGPLQNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSIKMTYEGDPIPIQRTHL
LERVTFLIYNLFKNSFLVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSIEETSNGSLSVEFRHLQPKEMKSSAGSKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSATLTQLLEVMSWQFSSYVGRGLNSEQLSMLAEKLTVQSCYNDGHLTWAKFCK
EHLPGKPFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERFLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPQSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgacacagtggaatcaagtccaacaattagaaatcaagtttttggagcaagtagatcaa
ttctatgatgacaacttccctatggaaatccgacatctgctggcccagtggattgagaat
caagactgggaggtggcatctaacaatgaaactatggcaacaattcttcttcaaaatttg
ttaatacaactggatgaacaattaggtcgtgtttccaaagagaaaaacctgctcttgata
cacaacctcaagagaattagaaaagttcttcagggaaaatttcatgggaatccaatgcat
gtagctgtggttatctcaaattgtctaagggaagagaggagaatattggctgcagccaac
atgcctgtccagggacctctggagaaatccttacaaagttcttcagtttcagaaagacag
agaaatgtggagcacaaagtggctgccattaaaaacagtgtacagatgacggaacaagac
accaaatacttagaagatctgcaagatgaatttgactacaggtataaaacaattcagaca
atggatcagagtgataagaatagtaccctgatgagccaggaagttttgacactgcaggaa
atgcttaacagcctggacttcaagagaaaggaagctctcagtaaggtgacacagatagtg
aatgagacagacttgctaatgaacagcatgctgacagaagagctgcaggactggaagagg
cggcaacagatcgcctgcatcggtggtccactccaaaacggcctggaccagcttcaaaac
tgttttaccttattggcggaaagtcttttccaactcagacggcaactggagaaactggag
gagcagtctatcaaaatgacctatgaaggcgatcccatccctatacaaagaacacacctg
ctggagagagtcaccttcttgatctacaaccttttcaagaactcatttttggttgagcga
cagccatgcatgccaacacaccctcagaggccgatggtacttaaaactctcattcagttc
actgtaaaactgagactattaataaaattaccagagctgaactatcaggtgaaagttaaa
gcatcaattgacaagaatgtttcaactctaagcaatcgaagatttgtcctttgtggaact
catgtcaaagctatgtccattgaggaaacttccaatgggagcctctcagtggaatttaga
catttgcaaccaaaggaaatgaagtccagtgctggaagtaaaggaaatgagggctgtcac
atggtgactgaagagcttcattccataacctttgagacacagatctgcctctatggcctt
accatcgatttggagaccagctcattacctgtggtgatgatttctaatgtcagccaatta
cctaatgcttgggcatccatcatttggtacaacgtatcaaccaacgattcccagaacctg
gttttctttaataatcctccatctgccactttgactcaactcttggaagtgatgagctgg
cagttttcatcctatgtcggtcgtggtcttaattcagaacagctcagcatgctggcggag
aagctcacagttcagtcttgctacaatgatggtcacctcacctgggccaagttctgcaag
gaacacttgcctggcaaaccatttaccttttggacctggcttgaagcaatattggactta
attaagaaacacattcttcccctttggattgatgggtatgtcatgggctttgtcagcaaa
gaaaaagaacggtttctgctaaaggataaaatgcctgggacgtttttattaagattcagt
gaaagccatcttggagggataacgttcacctgggtggaccattctgaaaacggagaagtg
agattccactcagtagaaccctacaacaaaggccgattgtcagcgctgccattcgctgac
attcttcgagactacaaagttattatggctgaaaacattcctgaaaaccctctgaagtac
ctttaccctgacattcccaaagacaaagctttcggtaaacactacagctcccagccttgc
gaagtttcaagaccaacagaaagaggagacaaaggctatgttccttctgtttttatcccc
atttcaacaatccgaagtgattccacagagccacaatctccatcggaccttctccccatg
tctccaagtgtatatgctgtgctgagagaaaacttgagccccacgacaattgaaactgcg
atgaagtctccatattctgctgaatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736156
Entry
103736156         CDS       T03372                                 

Gene name
Stat1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04062  Chemokine signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05140  Leishmaniasis
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05212  Pancreatic cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736156 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103736156 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103736156 (Stat1)
   04621 NOD-like receptor signaling pathway
    103736156 (Stat1)
   04625 C-type lectin receptor signaling pathway
    103736156 (Stat1)
   04658 Th1 and Th2 cell differentiation
    103736156 (Stat1)
   04659 Th17 cell differentiation
    103736156 (Stat1)
   04062 Chemokine signaling pathway
    103736156 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103736156 (Stat1)
   04935 Growth hormone synthesis, secretion and action
    103736156 (Stat1)
   04919 Thyroid hormone signaling pathway
    103736156 (Stat1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103736156 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736156 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103736156 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103736156 (Stat1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103736156 (Stat1)
   05160 Hepatitis C
    103736156 (Stat1)
   05171 Coronavirus disease - COVID-19
    103736156 (Stat1)
   05164 Influenza A
    103736156 (Stat1)
   05162 Measles
    103736156 (Stat1)
   05168 Herpes simplex virus 1 infection
    103736156 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103736156 (Stat1)
   05169 Epstein-Barr virus infection
    103736156 (Stat1)
   05165 Human papillomavirus infection
    103736156 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103736156 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103736156 (Stat1)
   05140 Leishmaniasis
    103736156 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103736156 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103736156 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103736156 (Stat1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103736156 (Stat1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 STAT1_TAZ2bind TRPM_tetra DUF4407
Other DBs
NCBI-GeneID: 103736156
NCBI-ProteinID: XP_008833832
LinkDB
Position
Un
AA seq 754 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDDSFATILFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIYSCLKEERKILENAQ
RFNQAQAGNIQNTVMLDKQKELDSKVRNVKDQVMCIEHEIKTLEDLQDEYDFKCKTSQNR
ESEANSVAKNDQKQEQLLLHQMFLRLDNKRKEIVHKIIELLNATELTQNTLINNELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LSERTFILFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNADQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSHEVSRIVSSVEFDSMMSAV
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgagctgcagcagctggactccaaattcctggagcaggttcaccag
ctttatgatgatagttttcctatggaaatcaggcagtacctggctcagtggctagaaaaa
caagactgggaacatgctgcttatgatgattcatttgccaccattcttttccatgacctc
ctgtctcagctggatgatcagtacagccgcttttctttggagaataattttttgttgcag
cataatataaggaaaagcaagcggaaccttcaggataattttcaagaagatccggtgcaa
atgtctatgatcatctacagctgtctgaaggaagaaaggaagattttagaaaatgcccag
agatttaatcaggctcaggcggggaatattcagaacactgtgatgttagacaaacagaag
gaacttgacagcaaagtcagaaatgtgaaggaccaagttatgtgcatagagcatgaaatc
aagaccctagaagatttacaagatgaatatgactttaaatgcaaaacctcacagaataga
gaaagtgaagccaatagtgtagcaaagaatgaccagaaacaggaacagctgctgctccac
cagatgtttttaaggcttgacaacaagagaaaggagatagttcacaaaataatagagttg
ttgaatgccactgaacttacccagaataccttgattaataatgagctagtggagtggaag
cgaagacagcagagtgcctgtattgggggaccgcccaatgcttgccttgatcagctgcag
agctggtttactattgtcgcagagagtctgcaacaggttcgtcagcagcttaaaaagctg
gaagagttggaacagaagtatacctatgagcatgaccctatcacaaaaaataaacagggg
ttgtcagaacgcaccttcatcctcttccagcagctcattcagagctcatttgtggtggaa
agacagccgtgcatgccaactcatcctcagaggccactggttttgaagactggggtacag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtctcatttgataaagatgtgaacgaaagaaatacagtaaaaggatttcggaagttc
aacattctgggcacacatacgaaggtgatgaacatggaggagtccaccaatggaagtctg
gcagccgaatttcgacacctgcaattgaaagaacagaaaaatgctggcaacagaactaat
gagggtcctctcattgttactgaagagcttcactcccttagttttgaaacccagttgtgc
cagccaggcttggtaattgaccttgagactacctctctgccagttgtggtgatctccaac
gtcagccagctccccagtggttgggcctccatcctgtggtacaacatgctggtggcagaa
cccaggaatctgtccttcttcctgaacccaccatgtgcacggtggtctcagctatcagag
gttctgagttggcaattttcatctgtcacaaagagaggactcaacgcagaccagctgaac
atgttgggagagaagctccttggtcctaatgctggccctgatggtcttattccgtggaca
agattttgtaaagagaatattaatgataaaaacttttccttctggccttggattgacacc
atcctagaactcattaagaaacacctgctctgcctctggaatgatggatgtatcatgggc
tttatcagcaaggaaagagaacgtgctctgctcaaggaccagcagccagggaccttcctg
cttcggttcagcgagagctcccgggaaggagccatcacattcacatgggtggaacggtcc
caaaatggaggcgaacctgatttccatgcagttgaaccctatacaaagaaagaactttct
gctgttactttccctgatattattcgcaattataaagtcatggctgctgagaacattcca
gagaatcctctgaaatatctgtatcccaatattgacaaagaccatgcctttggaaagtat
tactccaggccaaaggaagcaccggagccaatggaacttgatgaccctaaacgaactgga
tacatcaagactgagttgatttctgtgtctgaagtccacccttctagacttcagaccaca
gacaatctgctacccatgtctcccgaggagtttgatgaggtgtcccatgaggtgtcccgg
atagtgagctctgtagaatttgacagtatgatgagcgcagtataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742927
Entry
103742927         CDS       T03372                                 

Gene name
Stat6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04217  Necroptosis
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05161  Hepatitis B
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103742927 (Stat6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103742927 (Stat6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103742927 (Stat6)
   04659 Th17 cell differentiation
    103742927 (Stat6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742927 (Stat6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103742927 (Stat6)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103742927 (Stat6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103742927 (Stat6)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103742927 (Stat6)
SSDB
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2 ZapB
Other DBs
NCBI-GeneID: 103742927
NCBI-ProteinID: XP_008842312
LinkDB
Position
Un
AA seq 936 aa
MVPQRRGDFPLKVLLAWLPQPLRFPLGLASGRGVNPPRRDLAPPPAPFPAPTATATATAT
ATAAFTHRKTQKLFWLSMLRSHGQRSRNAPSTSQMMSLWSLVSKMSSEKLKQLYVDFPQH
LRHLLGDWLENQPWEFLVGSDTFCHHMASVLLSATVQRLQASAGEQGKGSTVFQHISTLE
SVYQRDPLKLVAILRQILQGEKKAILEEFRHLPVTFHWKQEELKFTTALRRLQHRVGEIR
IHREGLQQGTEAGQVSLRSLMGSPANGTDPRETLATMLQGTVGDLEAAQALVLKRIQIWK
RQQQLAGNGAPFEESLAALQERCESLVDIYSQLQQEVGAASGELEPKTRASLLSRLDEVL
RTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLRFLGTSAKPPLVRADMVTEKQARELS
LPQGSGAGAESTGEIMNNTVPLENSIPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCA
VLFSTSFLLGPNKTPIQLQTLSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAER
VPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKE
ILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLSEPDGTFLLRFSD
SEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAF
RSHYKPEQMGKDGRGYVPAIIKMTVERDQPLPTPEPQMPTMVPPYDLGMTPDASMQLSSD
MVYPPQSHSIPSFQDHPFEESIHVPPAFQEPHLRMLPSLSPLNLPFEQSQPQGLLQCRPQ
EHAVSSPEPLLCSDVTMVEDSCLTQQVAGFPQGAWLNEDMLPPLLPPTEQDLNKLLLEGQ
GETGGSLGAQPLLQPSPYGQSGISMSHLDLRANPSW
NT seq 2811 nt   +upstreamnt  +downstreamnt
atggtgccccagaggaggggggatttccccctcaaagtgctcctcgcttggctgccgcag
ccgctgagatttcccctagggctagccagcgggcgcggggttaaccctcctcgtagggac
ctggctccacctcccgcacccttccccgcccccacggccaccgccaccgccaccgccacg
gccaccgccgcattcacgcatcggaaaactcagaagctcttctggctttcgatgttgagg
tcccacggtcagcggagtcgcaatgcaccctccacatcccagatgatgtctctgtggagt
ctggtttcgaagatgtcctcagaaaaactgaaacagctgtatgttgactttccccagcac
ctgcggcatctcctgggtgactggctggagaaccagccatgggaattcctggttggctca
gatacattctgccaccacatggctagtgtcctcctctcagccactgtccagcgccttcag
gcctctgcaggagaacaggggaaaggaagcaccgtctttcagcacatcagcaccttggag
agtgtatatcagagggaccccttgaagctggtggccattctcagacaaatacttcaagga
gagaaaaaggccattttggaagagttccgccacctgccagtgacctttcactggaagcag
gaagaactcaagtttaccacagcccttcggagattgcagcaccgagtaggggagatccgt
attcaccgagaaggtctgcaacagggaacagaggctggccaagtgtctctgcggagcttg
atgggaagtcctgccaatgggactgatccaagagagaccctggccacaatgctgcagggg
actgtgggggacctggaggctgcccaggccttggtgctgaagaggatccagatttggaaa
cggcagcagcagctggcagggaatggtgcaccctttgaggagagcctagcagcactgcag
gagaggtgtgaaagcctggtggacatttattcccagctgcagcaggaggtaggggcagcc
agtggggagcttgagcccaagacccgggcatcactgctaagtaggctggatgaagtcctg
cgaacccttgtgaccagctctttcttggtggaaaagcagcccccccaggttctgaagact
cagactaagttccaggctggagttcggttcctgctgggcttgcggttcctggggacctca
gccaagcctccgctggtcagggctgacatggtgacagagaagcaggctagagaattaagc
ttgccccagggatctggggctggagcagagagcacaggggagatcatgaacaacacagtg
cctctggaaaacagcattcccgggaactgctgctctgccttgtttaagaacctgctcctg
aagaaaatcaagcggtgtgagaggaagggcaccgagtctgtcaccgaagagaagtgtgct
gtgcttttctccaccagcttcttgctcggccccaacaaaacccccatccagctccagacc
ctgtctttgcccttggtagtcatcgtccacggcaaccaagacaacaatgccaaagccacc
atcctatgggataatgccttctccgagatggaccgagtgccctttgtggtggctgagcga
gtgccctgggagaaaatgtgtgaaactctgaacctcaagttcatggctgaggtggggacc
aaccggggactactaccagaacacttcctcttcctggcccagaagatcttcaatgacaac
agcctcagtatggaggccttccagcatcgttctgtgtcctggtcacagttcaacaaggag
atcctgctgggccgtggcttcactttctggcagtggtttgatggtgtcctggacctcact
aaacgctgtctccggagctactggtcagaccggctgatcatcggcttcattagcaaacag
tatgtcacaagtcttctcctcagtgagccagatggaacctttctcctccgatttagtgac
tccgagattgggggcattaccattgctcatgtcatccggggtcaggatggctccccacag
atagagaacatccagccattttctgccaaagacctgtccattcgatcactgggggaccga
atccgggatcttgctcagctgaaaaacctttaccccaagaaacccaaggatgaagctttc
cggagccactacaagcctgaacagatggggaaagatgggaggggctatgtccccgctatc
atcaagatgactgtggaaagggaccagccccttcccactccagagccccagatgcctacc
atggtgcccccttatgatcttggaatgacccctgatgcgtccatgcagctcagctcagat
atggtgtaccctccacagtctcactctatcccctcatttcaagaccacccctttgaagag
tcaatccatgtaccgccagcctttcaggagcctcacctgcgaatgctccccagtctgagt
ccactgaacctgccctttgagcagtctcagccccagggcctgctgcagtgtcggcctcag
gagcatgctgtgtccagccctgaacccttgctctgttcagatgtgaccatggtagaagac
agctgcctaactcagcaggtggcaggtttcccccagggcgcctggctcaatgaagacatg
ttgcctcccctgctgcctcccactgaacaggatctcaacaagcttctcctggagggccaa
ggggaaacaggagggtccttgggtgcccagcccctcctgcagccatctccctatgggcaa
tctgggatctcaatgtcccatctggacctaagggccaatcccagttggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746519
Entry
103746519         CDS       T03372                                 

Gene name
Stat2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04062  Chemokine signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746519 (Stat2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103746519 (Stat2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103746519 (Stat2)
   04625 C-type lectin receptor signaling pathway
    103746519 (Stat2)
   04062 Chemokine signaling pathway
    103746519 (Stat2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103746519 (Stat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746519 (Stat2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103746519 (Stat2)
   05160 Hepatitis C
    103746519 (Stat2)
   05171 Coronavirus disease - COVID-19
    103746519 (Stat2)
   05164 Influenza A
    103746519 (Stat2)
   05162 Measles
    103746519 (Stat2)
   05168 Herpes simplex virus 1 infection
    103746519 (Stat2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103746519 (Stat2)
   05169 Epstein-Barr virus infection
    103746519 (Stat2)
   05165 Human papillomavirus infection
    103746519 (Stat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103746519 (Stat2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103746519 (Stat2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2 Saw1
Other DBs
NCBI-GeneID: 103746519
NCBI-ProteinID: XP_008846959
LinkDB
Position
Un
AA seq 836 aa
MAQWEMLKNLDNPFLDQLHQLYSQSILPMDVRQHLAAWIEDQNWREAVLGNDNSKANLLY
FHILDQLNQCDHYSPDPDYFLLQHNLRKFSRDIQTFPCGPTQLAEMIFNLLLEEKRILNQ
AQRAQVEQDRPTVETRVESQQFEIESRILDLQTMVEMLVKSIRQLKDLQDVFSFRYTIQK
KTSSSDPHQSQQLQLVQKTANDLDKMRKEVLDTSKALVGRLTTLIDLLLPKLDEWKGQQQ
KSCIGAPRPDLNLHQLEEWFTAGAKLLFHLRQLLKQLKEMGHMVQYEGDTFEKGVDLQNA
QVTELLQRLLQRAFVVETQPCMPQTVGRPLILKTGSKFTVRTRLLVRLQEGNVSLTAEVF
IDRNSQLQGFRKFNILTSNQKTLTPEKGQRQGLIWDFGFLTLLEQRSVGTGKGTNKGPLA
VTEELHIISFTVQYTYQGLKMELQTDTLPVVIISNMSQLSIAWASVLWFNMLSPTPQNRQ
FFCKPPKAPWSLLGPVLSWQFSSSIGRGLNSEQLGMLRNKLFGKNCKMEDALLSWSDFSK
RESPPGKIPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRTQERRLLKKTVSGTFLLRFS
ETSEGGITCSWVEHQEDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQVLAEENIPENPLRF
LYPRIPRDEAFGFYYQEKVNLEERRKYLKHRLIVVSTRQVDELQQPPELKLEPELESLEL
DPGLVSVTELGQDLELESLLKAGLDLNLEPSLCMAPQRMLGPDLRPALQPLQEPDLPHDL
QQLNTMEMEIFRNNIKIEDIMPHGDPLLAGQSIMDEAYISCRSHFDVDGPLIPSDD
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcacagtgggagatgctgaagaatcttgacaacccatttctggaccagctgcaccag
ctatactcacaaagcatcctgccaatggacgtccgtcagcacttggctgcttggattgaa
gaccagaactggagggaagctgtgctaggcaatgataattccaaggccaatctgctatac
ttccacatcttggaccaactgaaccagtgtgaccactacagcccagatcctgattatttt
ttactacagcataacttgcgaaaattcagccgggacattcagacctttccctgtggtcct
acccagttggctgagatgatctttaatcttcttctggaagaaaaaagaattctgaatcag
gcccaaagggctcaagtggagcaagacaggccaactgttgaaacaagggtggagagccaa
cagtttgagattgaatcccggatcctggatttacagactatggtggagatgttggtgaag
tctatcaggcaactaaaagatctgcaggatgtcttcagcttcagatacacgattcaaaag
aagacatcctcttcggacccacatcagagccaacagctgcagcttgtgcagaaaactgcc
aatgacctggacaaaatgagaaaggaggtgctagatacctccaaagcactagtaggccga
ttaaccaccttgattgacctgctgctgccaaagttggatgagtggaaagggcagcagcag
aaatcctgtattggagccccacgacctgacctcaacctacatcagctggaagagtggttc
acggctggagcaaaactgttgtttcacctacggcagctgctaaaacagctaaaggaaatg
ggtcacatggttcagtatgagggtgacacttttgaaaaaggagtggatctgcaaaatgcc
caagtcacagagttgctacaacgtctactccaaagagcctttgtggtggaaactcagccc
tgcatgccccaaactgtcggtcgcccccttatcctgaaaactggaagcaagttcactgtt
cgaacaaggctgctagtacgactccaggaaggcaatgtgtcactcacagcagaagtcttc
atcgacaggaattctcagttacaaggcttccggaaattcaacattctgacctccaaccaa
aaaaccttgacccctgagaaggggcagagacaaggcttaatttgggactttggcttcttg
acgctgttggagcaacgttcagttggtacaggaaagggtaccaataaggggccgctggct
gtgacagaggagttacacatcatcagcttcacagtccagtacacataccagggtctgaag
atggagctgcaaacggacactcttcctgtggtgattatttctaacatgagtcaactctcc
attgcctgggcctcagttctctggttcaatatgctcagcccaaccccccagaaccggcag
ttcttctgcaaacctcccaaggccccttggagcttgctggggcctgttctcagctggcag
ttctcctcctctattggccgaggcctcaattcagagcagctgggcatgctgaggaacaag
ctgtttggaaagaactgcaagatggaggatgcattgttgtcctggtcggactttagtaag
cgagaaagcccccctggcaagattccattctggacatggttggacaaaatcctggagctg
gtacatgaccacctgaaggatctctggaatgatggtcgcatcatgggctttgtgagccgg
acccaggagcgtcgactgctgaagaagaccgtctctggcacctttctgttgcgcttcagt
gaaacttctgaagggggcattacctgctcctgggtggagcaccaggaggatgataaggtg
ctcatctactccgtgcagccctacaccaaggaggtactgcagtctcttcccctgactgaa
atcatccgccactaccaggttcttgctgaagagaacatccccgagaacccgctacgtttc
ctctacccccgaatccctcgggatgaggcttttggcttctactaccaagaaaaagtcaac
cttgaagaacggaggaaatacctgaaacaccggctcattgtggtctctaccagacaggtg
gatgagctgcagcaaccaccagagcttaaactggagccagaactggagtctttagagctg
gatccagggttggtgtcagtgacagagttaggacaagacctggagttagagtcactgctg
aaagcaggactggatctgaatctagagccctcactatgcatggccccacaaagaatgctg
gggccagacctgagacctgcactgcagccattgcaagagccagatttgccccatgatctg
cagcagttgaacaccatggaaatggaaatcttcagaaacaacataaagattgaagatatc
atgccccatggtgacccactgttggctggccagagcatcatggatgaggcttacatttcc
tgtcgtagccattttgatgtggatggaccattgattccttctgatgactag

DBGET integrated database retrieval system