KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735896
Entry
103735896         CDS       T03372                                 

Gene name
Stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04217  Necroptosis
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04931  Insulin resistance
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05145  Toxoplasmosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103735896 (Stat3)
   04066 HIF-1 signaling pathway
    103735896 (Stat3)
   04068 FoxO signaling pathway
    103735896 (Stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103735896 (Stat3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103735896 (Stat3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103735896 (Stat3)
   04062 Chemokine signaling pathway
    103735896 (Stat3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103735896 (Stat3)
   04917 Prolactin signaling pathway
    103735896 (Stat3)
   04935 Growth hormone synthesis, secretion and action
    103735896 (Stat3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735896 (Stat3)
   05206 MicroRNAs in cancer
    103735896 (Stat3)
   05205 Proteoglycans in cancer
    103735896 (Stat3)
   05203 Viral carcinogenesis
    103735896 (Stat3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103735896 (Stat3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103735896 (Stat3)
   05221 Acute myeloid leukemia
    103735896 (Stat3)
   05223 Non-small cell lung cancer
    103735896 (Stat3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103735896 (Stat3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103735896 (Stat3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103735896 (Stat3)
  09172 Infectious disease: viral
   05162 Measles
    103735896 (Stat3)
   05161 Hepatitis B
    103735896 (Stat3)
   05160 Hepatitis C
    103735896 (Stat3)
   05163 Human cytomegalovirus infection
    103735896 (Stat3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103735896 (Stat3)
   05169 Epstein-Barr virus infection
    103735896 (Stat3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103735896 (Stat3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103735896 (Stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103735896 (Stat3)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103735896 (Stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 103735896
NCBI-ProteinID: XP_008833515
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctcgacacacggtacctggagcaacttcatcag
ctgtacagtgacagcttccccatggagctacggcagttcctggcaccttggattgagagt
caagattgggcatatgcagccagcaaagagtcacatgccacgctggtatttcataacctc
ctgggtgagattgaccagcaatacagccgcttcctgcaagagtccaatgtcctctatcag
cacaacctgcgaagaatcaagcagttcctccagagcaggtatcttgagaaaccaatggaa
attgcccggattgtggcccggtgcctgtgggaagagtcccgcctcctccagacggcagcc
actgcagcccagcaagggggtcaggccaaccaccctacagctgctgtggtgacggagaag
cagcagatgctggaacagcaccttcaggatgttcggaaacgtgtgcaggatctagaacag
aaaatgaaagtggtagagaatctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtctgtgaccaggcagaagatg
cagcagctggaacagatgctcacagcgctggaccagatgcggagaagcattgtgagtgag
ttggcggggcttttgtcagcgatggagtatgttcagaaaacgcttacagatgaagagctg
gctgactggaagaggcggcaacagattgcctgcattggcggccctcccaacatctgcctg
gatcgtctagaaaactggataacctcattagcagaatctcaacttcagacccgccaacaa
attaagaaactggaggaattgcagcaaaaagtttcctataaaggggaccctattgtacaa
caccggccaatgctggaggagagaattgtggagctattcagaaacttaatgaaaagtgcc
ttcgtggttgagcggcagccctgcatgcccatgcaccctgaccggcccttagtcatcaag
actggtgtccagtttaccactaaagtcaggttgctggtcaaatttcctgagttgaattac
cagcttaaaattaaagtgtgcattgacaaagactccggggacgttgctgccctcagagga
tcccggaaatttaacattctgggcacaaacacaaaagtgatgaatatggaagagtccaac
aatggcagcctgtctgcggaattcaagcacttgaccctgagggagcagagatgtgggaat
gggggccgtgccaattgtgatgcttccttgattgtgactgaggagctgcacctgatcaca
tttgagactgaggtctaccaccaaggcctcaagatcgacctagagacccattccttgcca
gttgtggtgatttccaacatctgtcagatgccaaatgcctgggcatcgatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagcctccaattggaacc
tgggatcaagtagctgaggtgctgagctggcagttctcctccaccacaaaaagagggctg
agcatcgagcagctgactacgctggctgagaagctcttaggacctggcgtgaactactca
gggtgtcaaatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaatatcattgaccttgtgaagaagtacatcctggccctttgg
aatgaagggtacatcatgggctttatcagcaaggagcgggagcgggccatcctgagcacc
aagcccccgggtaccttcctactgagattcagcgagagcagcaaagaaggaggggtcact
ttcacttgggtggagaaggacatcagtggcaagacccagatccagtcggtggagccgtac
acaaagcaacagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgctacaaacatcctggtgtctcctctggtctatctctaccctgacattcctaaggag
gaagcatttggaaagtattgtcggccagagagccaggagcatcctgaagctgacccaggt
agtgctgccccttacctgaagaccaagttcatctgtgtgactccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgagccctcagcaggaggacagtttgagtcactcacgtttgacatggag
ctgacctcggagtgtgctacctcccccatgtga

DBGET integrated database retrieval system