KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736084
Entry
103736084         CDS       T03372                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04390  Hippo signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103736084 (Fgf1)
   04014 Ras signaling pathway
    103736084 (Fgf1)
   04015 Rap1 signaling pathway
    103736084 (Fgf1)
   04390 Hippo signaling pathway
    103736084 (Fgf1)
   04151 PI3K-Akt signaling pathway
    103736084 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103736084 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736084 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103736084 (Fgf1)
   05218 Melanoma
    103736084 (Fgf1)
   05224 Breast cancer
    103736084 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103736084 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103736084 (Fgf1)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103736084 (Fgf1)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103736084 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103736084
NCBI-ProteinID: XP_008833749
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFAALTEKFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKGTESGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYVSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacgaccttcgcagccctgaccgagaagtttaatctgcctcta
ggaaactacaagaagcctaaactgctctactgcagcaacgggggccactttctgaggatc
cttccagatggcactgtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctgagtgcggaaagcgtgggcgaggtgtatataaagggaactgagtctggccagtacttg
gccatggacacggatggacttttatatggctcacagacaccaaatgaagaatgcttgttc
ctggaaaggctggaggaaaaccattacaacacctacgtatccaagaagcatgctgagaag
aactggtttgtcggcctcaagaagaacggaagctgcaagcgcggtcctcggactcactac
ggccagaaagcaatcttgtttctccccctaccagtgtcttctgattag

DBGET integrated database retrieval system