KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736246Help
Entry
103736246         CDS       T03372                                 

Gene name
Pfkp
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00010  Glycolysis / Gluconeogenesis
ngi00030  Pentose phosphate pathway
ngi00051  Fructose and mannose metabolism
ngi00052  Galactose metabolism
ngi01100  Metabolic pathways
ngi01200  Carbon metabolism
ngi01230  Biosynthesis of amino acids
ngi03018  RNA degradation
ngi04152  AMPK signaling pathway
ngi05230  Central carbon metabolism in cancer
Module
ngi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103736246 (Pfkp)
   00030 Pentose phosphate pathway
    103736246 (Pfkp)
   00051 Fructose and mannose metabolism
    103736246 (Pfkp)
   00052 Galactose metabolism
    103736246 (Pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103736246 (Pfkp)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103736246 (Pfkp)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103736246 (Pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103736246 (Pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ngi03019]
    103736246 (Pfkp)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103736246 (Pfkp)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103736246 (Pfkp)
Messenger RNA biogenesis [BR:ngi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103736246 (Pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103736246
NCBI-ProteinID: XP_017655676
LinkDB All DBs
Position
Un
AA seq 795 aa AA seqDB search
MNDDSSSSRGSLPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIY
EGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKAFRSREGRLKAACNLVRLGITN
LCVIGGDGSLTGANLFREEWNGLLEELARNGEIDKDAVQKYSYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEEGWEETMCFKLSENRARKKRLNIIIVAEGAIDTQNKPISSEKIKELVVKQLGYDTR
VTILGHVQRGGTPSAFDRILGSRMGVEAVVALLEATPETPACVVSLRGNHAVRLPLVECV
QMTQDVQKAMDERRFKDAVQLRGRSFEGNLKTYKRLAIKMPDDKITKSNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHKMLAVYDGFDGFAKGQIKEIGWADVGGWTGQGGSLLGTKR
ILPGKYLEKIAEQMRIHNINALLVIGGFEAYLGLLELAAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGAD
AAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWITGKLKGSLGAGKKFVNDDSICVLG
ISKRDLLFQPVAELRKETDFEHRIPKHQWWLKLRPLMKILAKYKASYDVSDSGKLEPLVR
HHQHHHTPHGEPAAI
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgactcctcgtcctccaggggctccttgccgaagtacttggagcatctctca
ggggatggcaaagccatcggcgtcctgaccagcggcggggatgcccaaggtatgaacgct
gcggtccgcgctgtggtgcgcatgggaatatacgtgggggccaaagtatactttatatac
gagggttaccaaggcatggtggatggaggttctaatattgtggaagcagactgggagagt
gtctcgagcattctgcaagtgggtggaacgattattggcagcgcccgttgcaaagccttt
cgtagccgagaagggcgactgaaagccgcctgtaacctggttcggctgggcatcaccaac
ctgtgtgtgatcggtggggacggaagcctcactggggccaacctctttcgggaggagtgg
aacggacttctggaggagctggcccgaaatggtgagatcgataaggacgcagtgcagaag
tattcatacctcaatgtggtgggcatggtgggctccatcgacaacgacttctgtggcaca
gacatgaccatcggcacagactcagctctgcaccgaattattgaagttgttgacgccatc
atgactactgcccagagtcaccagaggaccttcgtcctggaggtgatggggcgacactgt
gggtacctggccttggtaagtgctttggcttgtggtgcagactgggtgttccttccagag
tctccaccagaggaaggttgggaggaaaccatgtgcttcaaactttcagagaaccgtgcc
cgaaaaaagagactgaatattattattgtagcagaaggagcaattgatacccaaaacaaa
ccgatcagctctgagaaaatcaaggagctcgtggtgaagcagctgggttacgacacccgg
gtgaccattcttggacacgtgcaacgaggtgggaccccttctgcgtttgacaggattttg
ggcagccgcatgggtgtggaggcggttgtcgccctgttggaggccactcctgagaccccg
gcctgcgtcgtgtcactgagaggaaaccacgccgtgcgcttacccctggtggagtgcgtg
cagatgacccaggatgtacaaaaggcaatggatgaaaggagatttaaagatgctgtacag
ctccgaggcaggagctttgagggaaacctcaagacctacaagcgacttgccatcaagatg
cctgatgacaagatcaccaagagcaattgcaacgtggctgttatcaatgtgggggcacca
gcagctggaatgaatgcagccgtccgctccgcagtgcgagtggggatcgcagacggccac
aagatgttagcggtgtacgatggcttcgatggcttcgccaaaggccagatcaaagaaatc
ggctgggcagatgttggaggttggactggccaaggagggtcccttcttgggacaaaacgc
atcctacctgggaagtacttggagaagattgctgaacagatgcgcatccataatatcaat
gccctcctggtcattggcggattcgaggcctacctgggactcctggagctggcagctgcc
cgggagaagcacgaggagttctgtgtccccatggtcatggttcctgccactgtctccaac
aatgtgccaggctccgatttcagcatcggggcagacacagctttgaacactatcacagac
acgtgtgaccgaatcaagcagtcggccagcgggaccaagcgtcgggtgttcatcattgag
accatgggcggctactgcggctacctggccaacatgggggggctggcagccggagctgat
gccgcctacatttttgaagagccctttgatatcagagatctgcagtccaacgtggagcac
ctgacagagaaaatgaagactaccatccagaggggcctcgtactcagaaatgaaagctgc
agtgtgaattacaccactgacttcatctaccagctatactcagaggagggcaaaggcgtg
tttgactgcaggaagaacgtcctgggccacatgcagcaggggggagcaccttctccattt
gatagaaactttggaaccaaaatctctgcaaaagctatggagtggatcaccgggaaactg
aagggatccctgggcgcagggaaaaaatttgttaatgacgattccatttgtgtcctggga
ataagcaaaagagacctcctttttcaaccagtggcagaattgaggaaggaaacagatttt
gagcaccggattcccaaacaccagtggtggctgaaacttcggcctctcatgaagatcttg
gccaagtataaggcaagctacgacgtgtctgactctggcaagctagagcccttggtacgc
caccaccaacaccaccataccccccacggggagcctgcagccatctga

DBGET integrated database retrieval system