KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736801
Entry
103736801         CDS       T03372                                 

Gene name
Map2k1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi04270  Vascular smooth muscle contraction
ngi04370  VEGF signaling pathway
ngi04371  Apelin signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04730  Long-term depression
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05034  Alcoholism
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103736801 (Map2k1)
   04012 ErbB signaling pathway
    103736801 (Map2k1)
   04014 Ras signaling pathway
    103736801 (Map2k1)
   04015 Rap1 signaling pathway
    103736801 (Map2k1)
   04370 VEGF signaling pathway
    103736801 (Map2k1)
   04371 Apelin signaling pathway
    103736801 (Map2k1)
   04668 TNF signaling pathway
    103736801 (Map2k1)
   04066 HIF-1 signaling pathway
    103736801 (Map2k1)
   04068 FoxO signaling pathway
    103736801 (Map2k1)
   04072 Phospholipase D signaling pathway
    103736801 (Map2k1)
   04071 Sphingolipid signaling pathway
    103736801 (Map2k1)
   04024 cAMP signaling pathway
    103736801 (Map2k1)
   04022 cGMP-PKG signaling pathway
    103736801 (Map2k1)
   04151 PI3K-Akt signaling pathway
    103736801 (Map2k1)
   04150 mTOR signaling pathway
    103736801 (Map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103736801 (Map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103736801 (Map2k1)
   04210 Apoptosis
    103736801 (Map2k1)
   04218 Cellular senescence
    103736801 (Map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103736801 (Map2k1)
   04540 Gap junction
    103736801 (Map2k1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103736801 (Map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103736801 (Map2k1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103736801 (Map2k1)
   04620 Toll-like receptor signaling pathway
    103736801 (Map2k1)
   04650 Natural killer cell mediated cytotoxicity
    103736801 (Map2k1)
   04660 T cell receptor signaling pathway
    103736801 (Map2k1)
   04662 B cell receptor signaling pathway
    103736801 (Map2k1)
   04664 Fc epsilon RI signaling pathway
    103736801 (Map2k1)
   04666 Fc gamma R-mediated phagocytosis
    103736801 (Map2k1)
   04062 Chemokine signaling pathway
    103736801 (Map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103736801 (Map2k1)
   04929 GnRH secretion
    103736801 (Map2k1)
   04912 GnRH signaling pathway
    103736801 (Map2k1)
   04915 Estrogen signaling pathway
    103736801 (Map2k1)
   04914 Progesterone-mediated oocyte maturation
    103736801 (Map2k1)
   04917 Prolactin signaling pathway
    103736801 (Map2k1)
   04921 Oxytocin signaling pathway
    103736801 (Map2k1)
   04926 Relaxin signaling pathway
    103736801 (Map2k1)
   04935 Growth hormone synthesis, secretion and action
    103736801 (Map2k1)
   04919 Thyroid hormone signaling pathway
    103736801 (Map2k1)
   04928 Parathyroid hormone synthesis, secretion and action
    103736801 (Map2k1)
   04916 Melanogenesis
    103736801 (Map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103736801 (Map2k1)
  09156 Nervous system
   04725 Cholinergic synapse
    103736801 (Map2k1)
   04726 Serotonergic synapse
    103736801 (Map2k1)
   04720 Long-term potentiation
    103736801 (Map2k1)
   04730 Long-term depression
    103736801 (Map2k1)
   04722 Neurotrophin signaling pathway
    103736801 (Map2k1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103736801 (Map2k1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736801 (Map2k1)
   05206 MicroRNAs in cancer
    103736801 (Map2k1)
   05205 Proteoglycans in cancer
    103736801 (Map2k1)
   05230 Central carbon metabolism in cancer
    103736801 (Map2k1)
   05231 Choline metabolism in cancer
    103736801 (Map2k1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103736801 (Map2k1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103736801 (Map2k1)
   05212 Pancreatic cancer
    103736801 (Map2k1)
   05225 Hepatocellular carcinoma
    103736801 (Map2k1)
   05226 Gastric cancer
    103736801 (Map2k1)
   05214 Glioma
    103736801 (Map2k1)
   05216 Thyroid cancer
    103736801 (Map2k1)
   05221 Acute myeloid leukemia
    103736801 (Map2k1)
   05220 Chronic myeloid leukemia
    103736801 (Map2k1)
   05218 Melanoma
    103736801 (Map2k1)
   05211 Renal cell carcinoma
    103736801 (Map2k1)
   05219 Bladder cancer
    103736801 (Map2k1)
   05215 Prostate cancer
    103736801 (Map2k1)
   05213 Endometrial cancer
    103736801 (Map2k1)
   05224 Breast cancer
    103736801 (Map2k1)
   05223 Non-small cell lung cancer
    103736801 (Map2k1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103736801 (Map2k1)
   05022 Pathways of neurodegeneration - multiple diseases
    103736801 (Map2k1)
  09165 Substance dependence
   05034 Alcoholism
    103736801 (Map2k1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103736801 (Map2k1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103736801 (Map2k1)
   05135 Yersinia infection
    103736801 (Map2k1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103736801 (Map2k1)
   05170 Human immunodeficiency virus 1 infection
    103736801 (Map2k1)
   05161 Hepatitis B
    103736801 (Map2k1)
   05160 Hepatitis C
    103736801 (Map2k1)
   05164 Influenza A
    103736801 (Map2k1)
   05163 Human cytomegalovirus infection
    103736801 (Map2k1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103736801 (Map2k1)
   05165 Human papillomavirus infection
    103736801 (Map2k1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103736801 (Map2k1)
   01522 Endocrine resistance
    103736801 (Map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103736801 (Map2k1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103736801 (Map2k1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: STE group
  STE7 family
   103736801 (Map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 103736801
NCBI-ProteinID: XP_008834567
LinkDB
Position
Un
AA seq 393 aa
MPKKKPTPIQLNPTPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHMAGM
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccgacccccgatggctcggcggtg
aacgggaccagctcggcagagaccaacctggaggccttgcagaagaagctggaggagctg
gaacttgatgagcagcagcggaagcgccttgaagcctttctgacgcagaagcaaaaggtg
ggagagctgaaggatgacgactttgagaagatcagtgagctgggggctgggaatggtgga
gtggtgttcaaggtctctcacaagccatccggcctggtcatggccaggaagctaattcac
ttggagatcaaacctgcaatccggaaccagatcatccgggagctgcaagttctgcatgag
tgcaactccccatacattgtgggtttctatggagccttctatagtgatggcgagatcagc
atctgcatggagcacatggatggtgggtccttggatcaagtcctgaagaaagctggaaga
attcccgaacaaattttaggaaaagttagcattgcggtgataaaaggtctaacgtatctg
cgggagaagcataagataatgcacagagatgtcaagccctccaacatcctagtgaactcc
cgtggggagatcaagctctgtgattttggggtcagcgggcagctcattgactccatggcc
aactcctttgtgggcacgaggtcctacatgtcgccggagagactccaggggactcactac
tccgtgcagtcggacatctggagcatgggactctctctggtggagatggcggttgggagg
taccccatccctcctcctgatgccaaggagctggagctcctgtttggatgccaggtggag
ggagatgcggccgagacaccacccaggccaaggacccctgggaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaatgag
cctcctccaaaactgcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgtttaataaagaaccctgcagagagagcagatctgaagcaactcatggttcatgctttc
atcaagagatctgatgctgaggaggtagactttgcagggtggctctgttccaccattggc
cttaaccagcccagcacaccaacccacatggctggcatgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737276
Entry
103737276         CDS       T03372                                 

Gene name
Map2k2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi04270  Vascular smooth muscle contraction
ngi04370  VEGF signaling pathway
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04730  Long-term depression
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103737276 (Map2k2)
   04012 ErbB signaling pathway
    103737276 (Map2k2)
   04014 Ras signaling pathway
    103737276 (Map2k2)
   04015 Rap1 signaling pathway
    103737276 (Map2k2)
   04370 VEGF signaling pathway
    103737276 (Map2k2)
   04371 Apelin signaling pathway
    103737276 (Map2k2)
   04066 HIF-1 signaling pathway
    103737276 (Map2k2)
   04068 FoxO signaling pathway
    103737276 (Map2k2)
   04072 Phospholipase D signaling pathway
    103737276 (Map2k2)
   04071 Sphingolipid signaling pathway
    103737276 (Map2k2)
   04024 cAMP signaling pathway
    103737276 (Map2k2)
   04022 cGMP-PKG signaling pathway
    103737276 (Map2k2)
   04151 PI3K-Akt signaling pathway
    103737276 (Map2k2)
   04150 mTOR signaling pathway
    103737276 (Map2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103737276 (Map2k2)
  09143 Cell growth and death
   04210 Apoptosis
    103737276 (Map2k2)
   04218 Cellular senescence
    103737276 (Map2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103737276 (Map2k2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103737276 (Map2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103737276 (Map2k2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103737276 (Map2k2)
   04620 Toll-like receptor signaling pathway
    103737276 (Map2k2)
   04650 Natural killer cell mediated cytotoxicity
    103737276 (Map2k2)
   04660 T cell receptor signaling pathway
    103737276 (Map2k2)
   04662 B cell receptor signaling pathway
    103737276 (Map2k2)
   04664 Fc epsilon RI signaling pathway
    103737276 (Map2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103737276 (Map2k2)
   04929 GnRH secretion
    103737276 (Map2k2)
   04912 GnRH signaling pathway
    103737276 (Map2k2)
   04915 Estrogen signaling pathway
    103737276 (Map2k2)
   04917 Prolactin signaling pathway
    103737276 (Map2k2)
   04921 Oxytocin signaling pathway
    103737276 (Map2k2)
   04926 Relaxin signaling pathway
    103737276 (Map2k2)
   04935 Growth hormone synthesis, secretion and action
    103737276 (Map2k2)
   04919 Thyroid hormone signaling pathway
    103737276 (Map2k2)
   04916 Melanogenesis
    103737276 (Map2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103737276 (Map2k2)
  09156 Nervous system
   04720 Long-term potentiation
    103737276 (Map2k2)
   04730 Long-term depression
    103737276 (Map2k2)
   04722 Neurotrophin signaling pathway
    103737276 (Map2k2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737276 (Map2k2)
   05206 MicroRNAs in cancer
    103737276 (Map2k2)
   05205 Proteoglycans in cancer
    103737276 (Map2k2)
   05230 Central carbon metabolism in cancer
    103737276 (Map2k2)
   05231 Choline metabolism in cancer
    103737276 (Map2k2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103737276 (Map2k2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103737276 (Map2k2)
   05225 Hepatocellular carcinoma
    103737276 (Map2k2)
   05226 Gastric cancer
    103737276 (Map2k2)
   05214 Glioma
    103737276 (Map2k2)
   05216 Thyroid cancer
    103737276 (Map2k2)
   05221 Acute myeloid leukemia
    103737276 (Map2k2)
   05220 Chronic myeloid leukemia
    103737276 (Map2k2)
   05218 Melanoma
    103737276 (Map2k2)
   05211 Renal cell carcinoma
    103737276 (Map2k2)
   05219 Bladder cancer
    103737276 (Map2k2)
   05215 Prostate cancer
    103737276 (Map2k2)
   05213 Endometrial cancer
    103737276 (Map2k2)
   05224 Breast cancer
    103737276 (Map2k2)
   05223 Non-small cell lung cancer
    103737276 (Map2k2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103737276 (Map2k2)
   05022 Pathways of neurodegeneration - multiple diseases
    103737276 (Map2k2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103737276 (Map2k2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103737276 (Map2k2)
   05135 Yersinia infection
    103737276 (Map2k2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103737276 (Map2k2)
   05170 Human immunodeficiency virus 1 infection
    103737276 (Map2k2)
   05161 Hepatitis B
    103737276 (Map2k2)
   05160 Hepatitis C
    103737276 (Map2k2)
   05164 Influenza A
    103737276 (Map2k2)
   05163 Human cytomegalovirus infection
    103737276 (Map2k2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103737276 (Map2k2)
   05165 Human papillomavirus infection
    103737276 (Map2k2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103737276 (Map2k2)
   01522 Endocrine resistance
    103737276 (Map2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103737276 (Map2k2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103737276 (Map2k2)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: STE group
  STE7 family
   103737276 (Map2k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 103737276
NCBI-ProteinID: XP_008835302
LinkDB
Position
Un
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKAQHKPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVLDGADGEPHSVSPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGMFSSDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVQEVDFAGWLCRTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgttgccggcactcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctcagaggcgaacctggtagacctgcagaagaag
ctggaggagctggacctggatgagcagcagaggaagcggctagaggccttcctcactcag
aaggccaaggttggtgaactcaaggacgatgacttcgagagaatttctgagctgggtgcg
ggcaatggcggcgtggtcaccaaggcccagcacaagccgtcgggcctcatcatggccaga
aagctgatccacctggagatcaagccagccatccgaaaccagatcatccgagagctgcag
gtgctgcacgagtgcaactcgccttacattgtgggcttctatggagctttctatagtgat
ggcgagatcagcatctgcatggagcacatggatggtggctcactggaccaggtgctgaag
gaggcgaagcgcatccctgaggacattctggggaaggtcagcatcgcggtgctccggggc
ctggcgtacctccgtgagaaacatcagatcatgcaccgagatgtcaagccatctaacatc
ctggtgaactcaagaggcgagattaaactctgtgactttggcgtgagtggccagctcatt
gactccatggccaactcattcgtggggacaaggtcctacatgtccccagagcgtcttcag
ggcacacactactcagtgcagtcggatatctggagcatggggctgtcactggtggagctg
gccattggcaggtatcccatccccccacctgacgccaaggagctggaggccagttttggc
cggcctgtgctggacggggcagatggagagccacacagtgtctccccacggcctaggccc
cctggacgccccatcagtggtcatgggatggatagccggccagccatggccatcttcgaa
ctgctggactacattgtgaatgagccgcctcctaagctgcccagcggtatgttcagctcg
gatttccaggagtttgtgaataaatgcctcattaagaacccagcagagcgtgctgatctg
aaaatgctaatgaatcacacgttcatcaaacgctccgaggtgcaggaagtggactttgca
ggctggctgtgccgaaccctgcgactgaaccagcccagcacgcccacgcgcactgccgtg
tga

DBGET integrated database retrieval system