KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737138
Entry
103737138         CDS       T03372                                 

Gene name
Jun
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04024  cAMP signaling pathway
ngi04137  Mitophagy - animal
ngi04210  Apoptosis
ngi04310  Wnt signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04530  Tight junction
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05161  Hepatitis B
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05224  Breast cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
ngi05323  Rheumatoid arthritis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103737138 (Jun)
   04012 ErbB signaling pathway
    103737138 (Jun)
   04310 Wnt signaling pathway
    103737138 (Jun)
   04668 TNF signaling pathway
    103737138 (Jun)
   04024 cAMP signaling pathway
    103737138 (Jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103737138 (Jun)
  09143 Cell growth and death
   04210 Apoptosis
    103737138 (Jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103737138 (Jun)
   04530 Tight junction
    103737138 (Jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103737138 (Jun)
   04621 NOD-like receptor signaling pathway
    103737138 (Jun)
   04625 C-type lectin receptor signaling pathway
    103737138 (Jun)
   04660 T cell receptor signaling pathway
    103737138 (Jun)
   04658 Th1 and Th2 cell differentiation
    103737138 (Jun)
   04659 Th17 cell differentiation
    103737138 (Jun)
   04657 IL-17 signaling pathway
    103737138 (Jun)
   04662 B cell receptor signaling pathway
    103737138 (Jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103737138 (Jun)
   04915 Estrogen signaling pathway
    103737138 (Jun)
   04921 Oxytocin signaling pathway
    103737138 (Jun)
   04926 Relaxin signaling pathway
    103737138 (Jun)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103737138 (Jun)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103737138 (Jun)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737138 (Jun)
   05203 Viral carcinogenesis
    103737138 (Jun)
   05231 Choline metabolism in cancer
    103737138 (Jun)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103737138 (Jun)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103737138 (Jun)
   05211 Renal cell carcinoma
    103737138 (Jun)
   05224 Breast cancer
    103737138 (Jun)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103737138 (Jun)
   05321 Inflammatory bowel disease
    103737138 (Jun)
  09165 Substance dependence
   05030 Cocaine addiction
    103737138 (Jun)
   05031 Amphetamine addiction
    103737138 (Jun)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103737138 (Jun)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103737138 (Jun)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103737138 (Jun)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103737138 (Jun)
   05135 Yersinia infection
    103737138 (Jun)
   05133 Pertussis
    103737138 (Jun)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103737138 (Jun)
   05170 Human immunodeficiency virus 1 infection
    103737138 (Jun)
   05161 Hepatitis B
    103737138 (Jun)
   05171 Coronavirus disease - COVID-19
    103737138 (Jun)
   05162 Measles
    103737138 (Jun)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103737138 (Jun)
   05169 Epstein-Barr virus infection
    103737138 (Jun)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103737138 (Jun)
   05142 Chagas disease
    103737138 (Jun)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103737138 (Jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103737138 (Jun)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    103737138 (Jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha DUF3450 TFIIA Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 103737138
NCBI-ProteinID: XP_008835076
LinkDB
Position
Un
AA seq 333 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGGSSSGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYSAAGLAFPAQPQQQPPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGE
TPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTA
NMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgtttctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg
aacctggccgacccggtgggcagtctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgatc
atccagtccagtaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgtgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcacagccggtcagcggggcg
ggcatggtggcccccgcggtggcctcggtggcgggcggcggcagcagcagcggcttcagc
gccagcctgcacagcgagcctccggtctacgccaacctcagcaacttcaaccccggcgcg
ctgagcagcggtggcggggcgccctcctacagcgcggccggcctggcctttcccgcgcag
ccccagcagcagccgccgccgcagccgccgcaccacctgccccagcagatcccggtacag
cacccgcggctgcaagccctgaaggaagagccccagacggtgcctgagatgcccggagag
acgccgcccctgtcccctatcgacatggaatcgcaagagcggatcaaagcggagaggaag
cgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatcgcc
cggctggaggaaaaagtgaaaaccttgaaagcgcaaaactcggagctggcgtctacagcc
aacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagt
gggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system