KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737285
Entry
103737285         CDS       T03372                                 

Gene name
Gadd45b
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103737285 (Gadd45b)
   04064 NF-kappa B signaling pathway
    103737285 (Gadd45b)
   04068 FoxO signaling pathway
    103737285 (Gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103737285 (Gadd45b)
   04210 Apoptosis
    103737285 (Gadd45b)
   04115 p53 signaling pathway
    103737285 (Gadd45b)
   04218 Cellular senescence
    103737285 (Gadd45b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737285 (Gadd45b)
   05202 Transcriptional misregulation in cancer
    103737285 (Gadd45b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103737285 (Gadd45b)
   05212 Pancreatic cancer
    103737285 (Gadd45b)
   05225 Hepatocellular carcinoma
    103737285 (Gadd45b)
   05226 Gastric cancer
    103737285 (Gadd45b)
   05214 Glioma
    103737285 (Gadd45b)
   05216 Thyroid cancer
    103737285 (Gadd45b)
   05220 Chronic myeloid leukemia
    103737285 (Gadd45b)
   05217 Basal cell carcinoma
    103737285 (Gadd45b)
   05218 Melanoma
    103737285 (Gadd45b)
   05213 Endometrial cancer
    103737285 (Gadd45b)
   05224 Breast cancer
    103737285 (Gadd45b)
   05222 Small cell lung cancer
    103737285 (Gadd45b)
   05223 Non-small cell lung cancer
    103737285 (Gadd45b)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103737285 (Gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103737285 (Gadd45b)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103737285 (Gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103737285 (Gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103737285
NCBI-ProteinID: XP_008835312
LinkDB
Position
Un
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEGLLVAAQRQDRLTVGVYESAKLMNVDPDCVVLCLLA
MDEQEEEDIALQIHFTLIQSFCCDNEIDILRVSGMQRLAQLLGEPVETLGTTEARDLHCL
LVTNYHTDSWKSEGLVEVASYCQESRGNNQWVPYISLEER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactctggaggagctagtggcgtgcgataacgcggctcagaagatgcagacagtgacg
gccgctgtggaggggctgctggtggcggcgcagcgtcaggatcgcctcacggtgggggtg
tacgagtcggccaaactgatgaatgtggacccggactgcgtggtcttgtgcctcttggcg
atggacgagcaggaggaagaggacatcgcgttgcagatccacttcactctcatccagtcc
ttctgctgtgacaacgagattgacatcctccgcgtgtctggcatgcagaggttggcccag
ctgctgggggaacctgtcgagacgctgggcaccaccgaggcccgggacctgcactgcctg
ctggtcacgaactaccacacagattcttggaaaagcgaaggcctggtggaagttgccagt
tactgccaagaaagtcgaggcaataaccagtgggtcccctatatatccctggaggaacgc
tga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743354
Entry
103743354         CDS       T03372                                 

Gene name
Gadd45a
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103743354 (Gadd45a)
   04064 NF-kappa B signaling pathway
    103743354 (Gadd45a)
   04068 FoxO signaling pathway
    103743354 (Gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103743354 (Gadd45a)
   04210 Apoptosis
    103743354 (Gadd45a)
   04115 p53 signaling pathway
    103743354 (Gadd45a)
   04218 Cellular senescence
    103743354 (Gadd45a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743354 (Gadd45a)
   05202 Transcriptional misregulation in cancer
    103743354 (Gadd45a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103743354 (Gadd45a)
   05212 Pancreatic cancer
    103743354 (Gadd45a)
   05225 Hepatocellular carcinoma
    103743354 (Gadd45a)
   05226 Gastric cancer
    103743354 (Gadd45a)
   05214 Glioma
    103743354 (Gadd45a)
   05216 Thyroid cancer
    103743354 (Gadd45a)
   05220 Chronic myeloid leukemia
    103743354 (Gadd45a)
   05217 Basal cell carcinoma
    103743354 (Gadd45a)
   05218 Melanoma
    103743354 (Gadd45a)
   05213 Endometrial cancer
    103743354 (Gadd45a)
   05224 Breast cancer
    103743354 (Gadd45a)
   05222 Small cell lung cancer
    103743354 (Gadd45a)
   05223 Non-small cell lung cancer
    103743354 (Gadd45a)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103743354 (Gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103743354 (Gadd45a)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103743354 (Gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103743354 (Gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103743354
NCBI-ProteinID: XP_008842833
LinkDB
Position
Un
AA seq 165 aa
MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRSITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASGGAAQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctgcagagcagaagaccgaaaggatggacacggtgggc
gatgccctggaggaagtgctcagcaaggcgcggagtcagcgcagcatcaccgtcggggtg
tacgaggccgccaagctgctcaacgtcgaccccgacaacgtagttttgtgcctgctggct
gcggacgaagacgacgacagggacgtggctctacaaatccacttcaccctgatccaggcg
ttttgctgcgagaacgacatcaacatcctgcgcgtcagcaaccccggccggctggcggag
ctcctgctgttggagaccgacgcggggccggcggccagtgggggagccgcgcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcgtcacaatggaaggatcctgcctta
agtcaacttatttgtttttgtcgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751225
Entry
103751225         CDS       T03372                                 

Gene name
Gadd45g
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103751225 (Gadd45g)
   04064 NF-kappa B signaling pathway
    103751225 (Gadd45g)
   04068 FoxO signaling pathway
    103751225 (Gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103751225 (Gadd45g)
   04210 Apoptosis
    103751225 (Gadd45g)
   04115 p53 signaling pathway
    103751225 (Gadd45g)
   04218 Cellular senescence
    103751225 (Gadd45g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751225 (Gadd45g)
   05202 Transcriptional misregulation in cancer
    103751225 (Gadd45g)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103751225 (Gadd45g)
   05212 Pancreatic cancer
    103751225 (Gadd45g)
   05225 Hepatocellular carcinoma
    103751225 (Gadd45g)
   05226 Gastric cancer
    103751225 (Gadd45g)
   05214 Glioma
    103751225 (Gadd45g)
   05216 Thyroid cancer
    103751225 (Gadd45g)
   05220 Chronic myeloid leukemia
    103751225 (Gadd45g)
   05217 Basal cell carcinoma
    103751225 (Gadd45g)
   05218 Melanoma
    103751225 (Gadd45g)
   05213 Endometrial cancer
    103751225 (Gadd45g)
   05224 Breast cancer
    103751225 (Gadd45g)
   05222 Small cell lung cancer
    103751225 (Gadd45g)
   05223 Non-small cell lung cancer
    103751225 (Gadd45g)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103751225 (Gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103751225 (Gadd45g)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103751225 (Gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103751225 (Gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103751225
NCBI-ProteinID: XP_008852816
LinkDB
Position
Un
AA seq 159 aa
MTLEEVRGQDAVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgtggccaggacgcagttccggaaagcacagccaggatgcag
ggcgcggggaaagcgctgcacgaactgctgctgtcggcgcagcgccagggctgtctcacc
gctggcgtctacgagtccgccaaagtcctgaatgtggaccctgacaatgtgaccttctgc
gtgctggccgccgacgaggaggatgagggcgacatagccttgcagatccatttcacgctg
atccaggcgttttgctgcgagaacgacattgacatcgtgcgcgtgggtgatgtacagcgg
ttggcggcgatcgtgggcgccggcgatgaggcgggtgcgccgggcgacctgcactgtatc
ctcatttcgaacccgaatgaggacacgtggaaggatcccgccttggagaagctcagcttg
ttctgcgaggagagccgcagcttcaacgactgggtgcccagcattaccctcccagagtga

DBGET integrated database retrieval system