KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737289Help
Entry
103737289         CDS       T03372                                 

Gene name
Tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngi01002]
    103737289 (Tmprss9)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103737289 (Tmprss9)
Peptidases [BR:ngi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103737289 (Tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a Reprolysin_4 UPF0220
Motif
Other DBs
NCBI-GeneID: 103737289
NCBI-ProteinID: XP_008835316
LinkDB All DBs
Position
Un
AA seq 1098 aa AA seqDB search
MEPTAPDLQLVPEVTKEVPVAAPDSGCCRVAVAAAVVTSMVILTLGVLLAFLSAQGVHVE
HTAQLQGISFSSALHWENSDYYRTLTPVLQMLFVNSFQKTELEASCVGCTVLGYRDGNTS
VLVHFRLHFLLRALHPLSLALEEAILQEGIRTRLRKHGLPLATYGTLVSAELTGIHKGPM
TEKDLKSGHCPGNSFFCQNGQCVRKENPECDNTVDCADGSDEALCDCGLQPAIQADRIVG
GMEAALGEFPWQVSLRENGEHFCGATIIGARWLVSAAHCFNEFQDPADWTAYAGTVQLSG
SEASMVRTRVLRISKHPAYDADTADFDVAVLELLRPLRFGRYVQPACLPAATHVFPARRK
CLISGWGYLKEDFLVKPEVLQKATVELLDQSLCSSLYGHSLTDRMVCAGYLDGKVDSCQG
DSGGPLVCQELSGRFFLAGIVSWGIGCAEARRPGVYTRVTRLRDWILEVTSKASKPMVPT
VTPIPAIPSTSWITSPESWAASSSAQTTTDSSTTALDSVTTSKPQDCGARPAMEKPNRIV
GGLSAVSGEVPWQVSLKEGSRHFCGATVVDDRWLLSAAHCFNHTKVEQVYAHLGTASLLG
VGGSPVKLGLRRVALHPRYNPGILDFDVALLELAQPLKFNKFIQPVCLPLAIHKFPVGRK
CMISGWGNMQEGNGTKPDVLQKASVGILEQQMCSALYNFSLTDSMLCAGFLEGRVDSCQS
DSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYARITCFKEWILQTMSSGPGPMPHP
SISSILPLSSHPSQITAHPQIPEVTSRPRPITLGATSWVTPRQPNTTLSTRGPGTRGQTP
SADARGTTTSAQLPDCGLASPGALTRIVGGSAAGRGEWPWQVSLWLRHREHRCGAVLVAE
RWLLSAAHCFDIYGDPMQWVAFLGTPFLSGVEGQLERVSRIYLHPFYNLYTLDYDVALLK
LAVPVGSSRLVRPICLPGPARPPDGARCVITGWGSLREGGSMAQQLQKAAVHVLSEHTCR
HFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPG
VYTRVAAVRGWINQNIQE
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacggcacccgacttacagctcgtgccagaggtaacaaaggaagtccctgtc
gctgctcctgattctggctgctgtcgagtggctgtcgccgcagctgtggtcaccagcatg
gtcatcctcactctgggagtccttttggccttcctctctgcacagggcgtccacgtggag
cacactgcgcaactgcagggcatcagtttctccagcgcactgcactgggagaactcagat
tactaccgtacactcacacccgtgctgcagatgctgtttgtaaatagtttccagaagaca
gagttagaagccagctgtgtgggctgcacggtgctgggttacagggatgggaacaccagt
gttcttgtgcatttccggctacattttctgcttcgagccctccatccactgagcctggcc
ctggaggaggccattttgcaggagggcatccggacaaggctgaggaaacatggtctcccc
ctggctacctatggcacacttgtatcagctgagctcacaggaattcataaaggaccaatg
acagagaaagacttaaagtcaggtcactgtccagggaattctttcttctgtcagaacggc
cagtgtgtgcgcaaagagaacccggagtgtgacaacacggtggactgtgccgacggctct
gacgaggcactctgtgactgtggtttgcagccggccatccaggccgacaggatcgtgggc
ggcatggaggccgccctgggggagttcccctggcaggtcagcctccgcgagaatggcgag
cacttctgtggggccaccatcattggggccaggtggctggtgtctgccgcccactgcttc
aacgaattccaggaccccgcggactggacggcctacgcgggcaccgtgcaactcagcggc
tcggaggccagcatggtgcgcacgcgcgtgctccgcatctccaaacaccctgcctacgac
gcggacactgcggacttcgacgtggcggtgctggagctgctgcggccgctgcgcttcggc
cgctacgtgcagcccgcctgcctcccggccgccacgcacgtcttcccggcccgtaggaag
tgcctcatctccgggtggggctacctgaaggaggacttcctggttaaaccagaggtcctc
cagaaagccaccgtggagctgctggaccagagcctgtgctccagcctatatggccactcg
ctcactgacaggatggtgtgtgctggctacctagatgggaaggtggactcctgccagggt
gactcaggaggacccctggtgtgtcaggagctttctggaagattctttttggcaggcatt
gtgagctggggaattggttgtgcagaagcacggcggccaggggtatacacacgagtcacc
aggctacgagactggatcttggaggtgaccagcaaggccagcaagcccatggtgcccacg
gtgactcccatccctgccatccccagcacttcctggattaccagccctgagagctgggca
gccagcagctctgcccaaaccacaacagattccagcaccacagccctggactctgtcacc
acttccaagccacaagattgcggggccaggcccgcaatggagaagcccaatcgaattgtg
ggtggacttagtgctgtctctggggaggtaccctggcaggtcagcctgaaagaaggttcc
aggcacttctgtggagctactgtggtggatgatcgctggctgctgtctgctgctcactgc
ttcaaccacaccaaggtggagcaggtgtatgcgcacctgggcacagcgtccctgctgggt
gtcggtggcagtcctgtgaagctggggctccgaagggtggccctgcacccccgctacaac
ccaggcattctggactttgatgtggctttgctggagttggcccagccactgaagttcaac
aagttcatccagcctgtctgcctccccctggccatccacaagttccccgtgggccggaag
tgcatgatctcaggctggggcaacatgcaggaagggaatggcaccaagccagatgtgcta
cagaaggcgtccgtgggtatcctagaacagcagatgtgcagtgccttgtacaacttctcc
ctcacggacagcatgctctgcgccggcttcctcgagggcagagtggactcctgccagagt
gactcgggtggccctctggcttgtgaggagacacctggtgtcttctatctggctggcatc
gtgagctggggcattggctgtgcccaggccaagaagcctggcgtgtatgcgcgaatcacc
tgcttcaaggagtggatcctccagaccatgtcctctgggcctggccccatgcctcacccc
tccatctcctccatcctgcctctctctagccatccctcccagatcacagcccacccccaa
atcccagaggtcaccagcagacccagacccatcactctgggggctaccagctgggtgacc
cccagacagcctaacacaacactgtccactagaggccctggcaccaggggacagacgcca
tctgctgatgcccgaggtaccaccacgagtgcccagctgccagactgtggcctggcgtct
cctggggcactgacccggatcgtgggtggcagtgcggctgggcgaggtgagtggccgtgg
caggtgagcctgtggctgcgacaccgggagcatcgctgtggggctgtgctggtggctgag
aggtggctcctgtcggctgcccactgcttcgatatctatggagaccccatgcagtgggtg
gccttcctgggcaccccattcctgagtggagtggagggccagctggagcgggtctctcgt
atctatctccatccattctacaacctctacacgctggactatgacgtggcactgctgaag
ctggcggtgcctgtgggaagtagccgcctggtgcgccccatctgcctgcctggccctgcc
cggcccccggacggcgcgcgctgcgtcatcaccggctggggatcccttcgtgagggagga
tccatggcccagcagctacagaaggcagccgtgcacgtcctgagtgaacacacatgtcgt
cacttctacccggtgcagatcagcagccgcatgttgtgcgcaggcttcccgcagggcggt
gtggacagctgctcgggcgatgctgggggacccctggcctgcagggagccatctggccgg
tgggtgcttaccggggtcaccagctggggctacggctgtggccggccccacttcccgggt
gtctatactcgtgtggcggctgttcgaggatggataaaccagaacatccaagagtga

DBGET integrated database retrieval system