KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737431Help
Entry
103737431         CDS       T03372                                 

Gene name
Met
Definition
(RefSeq) MET proto-oncogene, receptor tyrosine kinase
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04360  Axon guidance
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi05100  Bacterial invasion of epithelial cells
ngi05144  Malaria
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05211  Renal cell carcinoma
ngi05218  Melanoma
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103737431 (Met)
   04015 Rap1 signaling pathway
    103737431 (Met)
   04010 MAPK signaling pathway
    103737431 (Met)
   04151 PI3K-Akt signaling pathway
    103737431 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103737431 (Met)
   04520 Adherens junction
    103737431 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103737431 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737431 (Met)
   05202 Transcriptional misregulation in cancer
    103737431 (Met)
   05206 MicroRNAs in cancer
    103737431 (Met)
   05205 Proteoglycans in cancer
    103737431 (Met)
   05230 Central carbon metabolism in cancer
    103737431 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103737431 (Met)
   05226 Gastric cancer
    103737431 (Met)
   05218 Melanoma
    103737431 (Met)
   05211 Renal cell carcinoma
    103737431 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103737431 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    103737431 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103737431 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103737431 (Met)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103737431 (Met)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  MET family
   103737431 (Met)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal Ninjurin He_PIG_assoc
Motif
Other DBs
NCBI-GeneID: 103737431
NCBI-ProteinID: XP_017654662
LinkDB All DBs
Position
Un
AA seq 1382 aa AA seqDB search
MKAPTVLAPGILVLLLTLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIRNLILHRH
HIYLGATNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCNSKVNLSGGIWKDNINMAL
IIDTYYDDQLISCGSVNRGTCQRHVLPRDNPADIQSEVHCMFSPQVDEESGQCPDCVVSA
LGAKVLLSEKERFINFFVGNTINSSYLPDHSLHSISVRRLKETQHGFKFLTDQSYIDVLP
EFQDSYPIKYIHAFESNRFIYFLTVQKETLNAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTRKEVFNILQAAYVSKPGINLAKQIGASPNDDILYAVFAQSKPDSAEPLNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSNEYRTE
FTTALQRVDLFMGQFNHVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRTVSFTPHVNF
LLDSHPVSPEVIVEHPLNQNGYTLVATGKKLTKIPLNGLGCGHFQSCSQCLSAPSFVQCG
WCHNRCVQSDECPNGTWTQEICLPTIYKVLPTSAPLEGGTMLTICGWDFGFKKNNKFDLR
KTKVLLSNESCTLSLSESTANTLKCTVGPTMSEHFNMSIIISNSRGTTQYSTFSYVDPVI
TSISPSYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISAE
FPVKLKIDLANRETSSFSYREDPVVYEIHPTKSFVSGGSTITGIGKNLNSVGIPKLVINV
HEAGRNYTVACQHRSNSEIICCTTPSLQQLNLQLPLRTKAFFMLDGIFSKHFDLIYVHNP
VFKPFERPVVISMGNENVLEIKGNDIDPEAVKGEVLTVGNKSCENIHSHSEAVLCTVPSD
LLKLNSELNIEWKQAVSSTVLGKVIVQPDQNFTGLVIGVVSTSMILLLLLGLFLWLKKRK
QIKDLGDERVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLADLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAEMRPSFSELVSKISAIFSTFIGEHYVHVNATYVNIKCVAPYPSLLSSQDNIDGEV
NT
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccccactgtgctggcacctggcatccttgtgctgctgcttaccttggtgcag
aggagccatggggagtgcaaggaggccctggtgaagtccgagatgaacgtgaacatgaag
tatcaactccccaacttcaccgcagaaacccccatccggaatctcatcctgcacagacat
catatttacctcggagccacgaactacatttatgttttaaatgacaaagaccttcagaag
gtggcagagtacaagactgggcctgtgttggaacacccagattgttttccatgtcaggac
tgcaacagcaaagtcaatttgtcaggaggcatttggaaggataacatcaacatggccttg
attattgacacatactatgatgaccagctcattagctgtggcagtgtcaacagaggaacc
tgccagcgccatgttcttccacgtgacaaccctgctgacatacagtctgaggtccattgc
atgttctccccccaggtggacgaagagtcaggccagtgtcctgactgtgtggtaagtgcc
ctcggagccaaagtcctcctgtctgaaaaagaacggttcatcaatttctttgtggggaac
accatcaattcttcctaccttccagatcattcattgcattcaatatcagtgagaaggctg
aaggaaacccaacatggctttaagtttttgacagatcaatcctatattgatgtcttacct
gagttccaagattcttaccccataaagtacatacatgcctttgaaagcaaccgttttatt
tactttctgactgtccaaaaggaaaccctcaatgctcagacttttcacacaagaataatc
aggttctgttctgtagactctgggttgcattcctacatggaaatgcctctggagtgtatt
ctcacagaaaagagaagaaagagatccacaaggaaggaagtgtttaatatcctccaagct
gcctatgtcagtaagcctgggatcaaccttgctaagcagataggagccagcccaaatgat
gacattctctatgcagtgtttgcccaaagcaagccagattcagctgaacccctgaatcga
tcggcagtgtgtgcattccctatcaagtatgtcaacgaattcttcaacaagattgtcaac
aaaaacaatgtgagatgtctccagcatttttatggccccaaccatgagcactgtttcaac
aggaccctgctgagaaattcctcaggctgtgaagtgcgcagcaatgaatatcgaacagaa
tttaccactgctttgcagcgtgttgacttattcatgggccaattcaaccacgtgctctta
acatctatatctaccttcattaaaggtgacctcaccattgcaaatctggggacgtcagaa
ggtagattcatgcaggttgtggtttctcgaacggtgtcattcacccctcatgtaaacttt
ctcctggattcccaccctgtgtctccagaagtgattgttgaacaccctttaaaccaaaat
ggctatacactggttgccacagggaagaagctcaccaagatcccattgaatggcctgggc
tgtggacatttccagtcctgcagtcagtgtctctctgccccttcctttgtgcagtgtggc
tggtgccacaatcgatgtgtgcaatcagatgaatgccccaacgggacatggactcaagag
atctgtctacctacaatctataaggttttacccactagtgcaccccttgaaggagggacc
atgctgaccatatgtggctgggactttggattcaagaagaataataaatttgacttaagg
aagaccaaagttcttctcagcaatgagagctgcaccttgtccttaagtgagagcacggcc
aatacgttgaaatgcacagttggtcctacgatgagtgagcacttcaatatgtccataatt
atctcaaacagccgaggaacaacacaatacagtacattttcctacgtagatcctgtaata
acaagtatttctccaagttacggtcctcaggctggaggcactttactcactctgaccgga
aagtacctaaacagtgggaattctagacacatttcgattggtgggaaaacatgtacttta
aaaagtgtgtcaaacagtattcttgaatgttataccccagctcaaaccatctctgctgag
tttcctgttaagttgaaaattgacctagctaaccgagaaacaagcagcttcagttaccgg
gaagaccccgttgtctatgaaatccaccccaccaaatcttttgttagtggtggaagcaca
ataacaggtattgggaaaaacctgaattcagtcggcatcccgaagctggtaataaatgtg
catgaagcaggaaggaactacacagtggcgtgtcagcatcgctctaattcagagatcatc
tgctgcaccactccttcactgcaacagctgaacctgcaactccccctgaggaccaaagcc
tttttcatgttagacgggatcttttccaaacactttgatctcatttatgtccataatcct
gtgtttaagccttttgaaaggccggtggtgatctcaatgggcaatgaaaatgtactcgaa
attaagggaaatgatattgaccccgaagctgttaaaggtgaagtgttaacagttggaaat
aagagctgtgagaatatacactcccattctgaagctgttttatgtacggtccccagtgac
ctgctgaaattgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgtc
cttggaaaagtgatagttcaaccagatcagaatttcacaggattggtaattggtgtggtc
tcaacatcaatgatacttttgttattactcgggcttttcctgtggctaaaaaagagaaag
caaattaaagatctgggtgatgaacgggtccgctatgatgcaagagtacacactcctcat
ttggataggcttgtcagtgcccgaagtgtaagtccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcttctcagaatgga
tcatgcagacaagtgcaatatcctctggcagacctgtcccccatcctaactagtggggac
tcggatatatccagcccattactgcaaaatactgtccacattgacctcagtgctctaaat
ccagagctggtccaagcagtccagcatgtagtgattgggcccagtagcctgattgtgcat
ttcaatgaagtcataggaagagggcattttggctgtgtctatcatgggactttgttggac
aatgatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacatcgga
gaagtttcccagtttctgactgagggaattatcatgaaagatttcagtcatcccaatgtt
ctctcactcttgggaatctgccttcggagtgaagggtccccactggtggttctgccatac
atgaagcatggagatcttcgaaatttcattagaaatgagactcataacccgactgtaaaa
gatcttataggatttggtcttcaagtagccaagggcatgaaatatcttgcaagcaagaag
tttgtccacagagacttagctgcaagaaactgtatgttggatgaaaagttcactgtcaag
gttgctgactttggtcttgccagggacatgtatgataaagaatactacagtgtacacaac
aaaacaggtgcaaaactgcccgtgaagtggatggctttagaaagtctgcaaactcagaag
tttaccaccaaatcagatgtgtggtccttcggcgtgcttctctgggagctgatgacaaga
ggagcccctccttatcctgacgtcaacacatttgatatcaccgtctacttgttgcaaggc
agacgactattacaaccagaatactgcccagaccccttgtatgaagtgatgctaaaatgc
tggcaccccaaagctgaaatgcgcccatcgttttctgagctggtctccaagatatcagca
atcttctccactttcattggggagcactacgtccatgtgaacgctacttatgtgaatata
aaatgtgttgctccatatccttctttgttgtcatcacaagacaacattgacggcgaggtg
aacacatga

DBGET integrated database retrieval system