KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737662
Entry
103737662         CDS       T03372                                 

Gene name
Cdkn1b
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04151  PI3K-Akt signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04934  Cushing syndrome
ngi05162  Measles
ngi05165  Human papillomavirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05206  MicroRNAs in cancer
ngi05215  Prostate cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103737662 (Cdkn1b)
   04066 HIF-1 signaling pathway
    103737662 (Cdkn1b)
   04068 FoxO signaling pathway
    103737662 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    103737662 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103737662 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737662 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    103737662 (Cdkn1b)
   05206 MicroRNAs in cancer
    103737662 (Cdkn1b)
   05203 Viral carcinogenesis
    103737662 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    103737662 (Cdkn1b)
   05220 Chronic myeloid leukemia
    103737662 (Cdkn1b)
   05215 Prostate cancer
    103737662 (Cdkn1b)
   05222 Small cell lung cancer
    103737662 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103737662 (Cdkn1b)
   04934 Cushing syndrome
    103737662 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    103737662 (Cdkn1b)
   05169 Epstein-Barr virus infection
    103737662 (Cdkn1b)
   05165 Human papillomavirus infection
    103737662 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103737662 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103737662
NCBI-ProteinID: XP_008835722
LinkDB
Position
Un
AA seq 199 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEESQRKW
NFDFQNHKPLEGRYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESLDVHGSRQALPLNG
SQANSEDSHLVDQMPDPSDSQAGLAEQCAGMRKRPATEDSSSQNKRANRTEENVSDGSPN
AGSVEQTPSKKPGLRRRQT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgagtgtctaacgggagccccagcctggagaggatggacgccagacaa
gcggagcaccccaagccctccgcctgcagaaacctcttcggcccggttaatcacgaagag
ttaacccgggacttggagaagcactgccgagatatggaagaggagagtcagcgcaagtgg
aatttcgattttcagaatcacaagcccctggagggcagatacgagtggcaggaggtggag
aagggcagcttgccggagttctactacagacccccgcgccccccgaagggcgcctgcaag
gtgccggcgcaggagagcctggatgtccacgggagccgccaggcgctgcctttaaacggg
tctcaggcaaactctgaggactcgcatttggtggaccaaatgccagacccatccgacagc
caggcggggttagctgagcagtgcgcagggatgagaaagcgacctgcaacagaagattct
tcttcgcaaaacaaaagggccaacagaactgaagaaaatgtctcagacggttccccaaac
gctggttctgtcgagcagacaccctctaagaagcctggtcttcgaagacggcaaacgtaa

DBGET integrated database retrieval system