KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737771
Entry
103737771         CDS       T03372                                 

Gene name
Lrp6
Definition
(RefSeq) LDL receptor related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05200  Pathways in cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103737771 (Lrp6)
   04150 mTOR signaling pathway
    103737771 (Lrp6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103737771 (Lrp6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737771 (Lrp6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103737771 (Lrp6)
   05226 Gastric cancer
    103737771 (Lrp6)
   05224 Breast cancer
    103737771 (Lrp6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103737771 (Lrp6)
   05022 Pathways of neurodegeneration - multiple diseases
    103737771 (Lrp6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103737771 (Lrp6)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103737771 (Lrp6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 103737771
NCBI-ProteinID: XP_008835834
LinkDB
Position
Un
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVRLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVLNQNLEIQPYDLS
IDIYSRYIYWTCEVTNVIDVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCTSGQCIDAALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCVGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFVCQRLLCPRMKGDGETMTSDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtgctgaggagcctcctggcctgcagcttctgcgtgctactgagagcggcc
cctttgttgctttatgcaaacagacgggacttgagattggttgatgctacaaatggcaaa
gagaacgctacgattgtagttggaggcttggaggacgctgctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagtgaagaagccattaagcgaactgaattt
aacaaaaccgagagtgtacagaatgttgttgtttctggattattgtcccccgatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcggattgaa
gtttccaatttagatggatctttacgaaaagttttattttggcaagagttggatcaacct
agagctattgccttagatccttcaagcgggttcatgtactggacagattggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagtcgctttgttataataaacactgaa
atttactggccaaatggactgactttggattatgaagaacggaagctttattgggcagat
gcaaagcttaatttcatccataaatcaaacctggatggaacaaatcgacaggcagtggtt
aaaggttcccttccacatccttttgccttaacgttatttgaggacacactgtactggact
gactggaatacacactccattttggcgtgcaacaagtatactggcgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccagcagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgcccaactggggtcagactcctggagaatgga
aaaacctgtaaagatggtgccactgaactattgcttttagcccgacggacagacttgagg
cgcatttctctggacacaccagattttacagacattgtcctgcagttagaagacatccgg
catgccattgccatagactacgatcctgtggaaggctatatctactggactgatgatgaa
gtgagggccatccgccgttcctttatagatggatctgggagtcagtttgtggtcactgct
cagattgctcatcctgatggtattgctgttgactgggttgcacgaaatctgtactggaca
gacactggcactgatcggatagaagtgacaaggctcaatggaaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcctatggttgggtatatg
tattggactgactggggagaaatcccgaaaattgaacgagctgctctggatggttctgac
cgagtggtactggttaatacttctcttggttggccaaatggtttagccttggattatgat
gaaggcacaatatactggggagatgccaaaacagacaaaattgaggttatgaatactgat
ggcactgggagacgagtactggtggaagacaaaattcctcacatatttgggtttaccttg
ttgggtgactatgtttactggactgattggcagaggcgtagtatcgaaagggtgcacaag
cgaagtgcagagagggagatcatcatagaccagctgcctgacctcatggggctcaaggcc
acaaatgttcatcgagtcattggttctaacccttgtgctgaggaaaatggggggtgtagc
catctttgcctctatagacctcagggtcttcgctgtgcctgtcccattggctttgaactc
atcagtgacatgaagacctgcattgtcccggaggcttttcttctcttttcccggagagca
gatatcagacggatatctctggaaacaaacaataataatgtggccattcctctcactggt
gtcaaagaagcttctgctttggattttgatgtcacagacaatcggatttactggactgat
atatcactcaagactatcagcagagcctttatgaatggaagtgcactggaacatgtagtc
gagtttggcttagattatccagaaggcatggcagtggattggcttgggaagaacttgtac
tgggcagacacaggaacaaatcgcattgaggtgtcaaagttggatggacagcaccggcag
gttttggtatggaaagaccttgacagtccccgagctctcgcattggaccctgctgaagga
tttatgtattggactgaatggggtggaaaaccaaagattgacagagctgctatggatgga
agtgagcgtaccacgttagttccaaatgtggggcgagcaaatggcctaactatcgattat
gctaaaaggaggctttactggacagacctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcaa
taccaagattacatctactggacggactggagccgacgcagcattgaacgtgccaacaaa
accagtggccaaaaccgcactatcatccagggccatttggattatgtgatggacatcctt
gtctttcactcctctcggcaggcagggtggaatgaatgtgcctccagcaatgggcactgc
tcccacctctgtctagctgtgccagttggaggttttgtgtgtggatgccctgcccactac
tctctgaatgccgataacaggacttgtagtgctccgaccactttcctgctcttcagtcaa
aagagtgccatcaaccgcatggtgattgatgaacagcagagtcctgacatcatccttcct
atccacagccttcggaatgtccgggccattgactatgaccctctggacaagcagctctat
tggattgactcacgacaaaacatgatccgaaaagcacaagaagatggtagccagggtttt
actgtagttgtaagctcagttctgaatcagaacctagaaatacagccatatgacctcagc
attgatatttatagccgctatatctactggacttgtgaagtgaccaatgtcatcgatgta
acaagattagatgggagatcaattggagtggttctaaaaggcgagcaagacagacctcga
gccattgtggtaaacccagagaaagggtatatgtattttaccaatcttcaggaacgatct
cccaaaattgagcgtgctgcactggatggaacagaacgggaggtcctctttttcagtggc
ttgagtaaaccaattgctttggctcttgatagtaagctgggcaagctcttctgggctgat
tctgatctccggcgaattgaaagcagcgatctttcaggtgccaataggatagtgttagaa
gactctaatatcttgcagcctgtgggtctgaccgtctttgaaaactggctgtattggatt
gataaacagcagcaaatgattgaaaaaattgatatgactggtcgagagggcagaaccaag
gtccaggcacgaattgcccaactaagcgacattcatgcagtaaaggaactgaaccttcag
gaatacagacaacacccttgtgctcaggataatggtggctgctcacatatttgccttgta
aaaggagatggtactacaaggtgctcctgtcccatgcacttagttctccttcaagatgag
ctgtcctgtggagaacccccaacgtgttctcctcagcagttcacttgtttcactggggaa
attgactgcatcccggtggcttggaggtgtgatggattcactgaatgtgaagaccatagt
gatgaactcaattgtcctgtatgctcagagtctcagttccagtgcaccagtggacagtgc
attgatgctgcccttcgatgcaatggtgatgcaaactgccaggataaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgttgtgccaatggtcagtgtgttgga
aagcacaagaaatgtgaccataatgtggactgcagtgacaaatctgatgaactggattgt
tatccaactgaagagccagcaccacaggccaccaatactgttggttcagttattggagta
attgtcaccatctttgtgtctggaaccatatactttgtctgccagaggctgctctgtcca
cgtatgaagggagatggggaaactatgaccagtgactatgtggttcacgggccagcatct
gtgcccctcggctatgttccgcacccaagttctctgtcaggatctcttccaggaatgtct
cgaggcaaatcaatgatcagctccctcagtatcatggggggaagcagtggacccccatat
gatcgagcacatgtcacaggagcatcatcaagcagttcttcaagcaccaaaggcacttac
tttcctgcaattttgaacccgccaccatcccccgctacagagcgatctcattacaccatg
gaatttggttattcttcaaatagcccttccactcacaggtcctacagttataggccatac
agctaccggcactttgcaccgcccactacaccctgcagcacagatgtctgtgacagtgac
tatgctcctagccggagaatgacctctgtggcaacagccaagggctataccagtgatttg
aactatgactcagaacctgtgcccccaccacccacaccccgaagccagtacttatcagct
gaggagaactatgaaagctgccccccctctccatacacagagcggagctactcccaccac
ctgtacccaccaccaccctctccctgcactgactcctcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744519
Entry
103744519         CDS       T03372                                 

Gene name
Lrp5
Definition
(RefSeq) LDL receptor related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05200  Pathways in cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103744519 (Lrp5)
   04150 mTOR signaling pathway
    103744519 (Lrp5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103744519 (Lrp5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103744519 (Lrp5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103744519 (Lrp5)
   05226 Gastric cancer
    103744519 (Lrp5)
   05224 Breast cancer
    103744519 (Lrp5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103744519 (Lrp5)
   05022 Pathways of neurodegeneration - multiple diseases
    103744519 (Lrp5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103744519 (Lrp5)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103744519 (Lrp5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 103744519
NCBI-ProteinID: XP_008844525
LinkDB
Position
Un
AA seq 1451 aa
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKQTGEKRKEILSALYSPMDI
QVLSQERQPPLHTRCEEDNGGCSHLCLLSPRDPFYTCACPTGVQLQDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGRDRRVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIIPE
AFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTDCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERMVVADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCAHSNGQCGQLCLAIPGGHRCSCASHYTLDPSSRNCSPP
STFLLFSQKFAISRMIPDDQRSPDLILPLHGLRNVRAIGYDPLDKFIYWVDGRQNIKRAK
DDGTQPSVLTSSGQSLSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGEAMGVVLRG
DRDKPRAIAVNAERGYLYFTNMQDHAAKIERAALDGTEREVLFTTGLIRPVALVVDNALG
KLFWVDADLKRIESCDLSGANRLTLEDSNIVQPVGLTVLGRHLYWIDRQQQMIERVEKTT
GDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPAHL
VLLQNLLTCGEPPTCSPDQFTCATGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFP
CARGQCVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCASGQCVLIKQQCDSFPDCADG
SDELLCEITNPPSDDTPAHSSAIGPIIGIILSLFVMGGVYFVCQRVMCQRYTGANGPFPH
EYVSGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSMNLVGGRGGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATTRPYRPYIIRGMAPPTTPCS
TDVCDSDYSTSRWKTSKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLF
PPPPSPCTDSS
NT seq 4356 nt   +upstreamnt  +downstreamnt
atgtactggacagactggggggagactccccggatcgaacgggcgggaatggatggcagc
acccggaagatcatcgtggactctgacatttactggcctaacgggctaaccattgaccta
gaggaacaaaagctgtactgggctgacgccaagctcagtttcatccaccgagccaacctg
gacggctctttccggcagaaggtggtggagggcagtctcacgcacccctttgccctgaca
ctctctggggacactctctactggacggactggcaaacccgctccatccacgcctgcaac
aagcagactggggagaagaggaaggagatcctcagcgccctctattcacccatggacatc
caggtgctcagccaggagcggcagcctcccttacacacccggtgtgaagaggacaacggt
ggctgctcccacctatgcctgctctccccgagggatcctttttacacgtgcgcctgcccc
actggggtacagcttcaggacaacggcaagacgtgtaaggcaggggctgaggaggtgctg
ctgctggcccggaggacagacctgcggaggatctcgctggacacgcccgacttcacagac
attgtgctgcaagtgggtgacatacgacatgccatcgctatcgactatgaccctctggag
ggctatgtgtactggacggacgatgaggtgcgggccatccgcagggcatatcttgatggg
tctggggcacagacactggtcaacacggagatcaacgaccctgatggcatcgctgtggac
tgggtcgcccgaaacctctactggacagacacaggcactgaccgcattgaggtgactcgc
ctcaatggcacctcccgaaagatcctggtgtctgaggacctggatgaaccccgggccatc
gtgctgcaccctgtgatgggcctcatgtactggacagattggggggagaatcccaaaatc
gagtgtgccaacctggatgggcgagatcggcgtgtcctggtgaacacctccctcgggtgg
cccaatgggctggccctggacctacaggagggcaagctgtactggggagatgccaagaca
gacaaaattgaggtgatcaatgtggatgggacaaaacggcggaccctgctggaagacaag
ctcccacacatttttgggttcacgctgctcggggacttcatctactggactgattggcag
cggcgcagtatcgaacgggtgcacaaggtcaaggccagccgggatgtcatcatcgatcag
ctacccgatctgatgggactcaaagcagtgaatgtggccaaagttgttggaaccaaccca
tgtgcggatgggaatgggggttgcagccatctatgtttctttacaccccacgccaccaag
tgcggctgccccatcggcctggagctgctgagcgacatgaagacctgtatcatccccgag
gccttcctggtcttcaccagcagagccaccatccacaggatctccctagaaaccaataac
aacgatgtggccatcccactcactggcgtcaaggaggcctccgcactggattttgacgtg
tccaacaaccacatctactggacggatgtgagcctcaagaccatcagccgagccttcatg
aacgggagctctgtagaacatgtgattgagtttggcctggactaccctgaaggcatggct
gtcgactggatgggcaagaacctctattgggcagacacagggacaaacaggatcgaggtg
gcccggctggatgggcagttccggcaggtgcttgtgtggagggatttggacaaccccagg
tctttggccctggatcccactaaaggatacatctactggactgagtggggcggcaagcca
aggatcgtgcgggcattcatggatgggactgattgcatgactctagtggacaaggtgggc
cgagccaatgacctcaccattgactatgctgaccagcgcctctactggaccgatctggat
accaacatgattgagtcgtctaacatgctgggtcaagagcgcatggttgttgcggacgac
ctgccctatccctttggcctgacacagtacagtgactacatctactggactgactggaac
ctgcacagcatcgagcgggctgataagaccagtgggcgaaaccgtaccctcatccagggc
cacctggacttcgtgatggatatcctggtgttccactcctcccgtcaggatggcctcaac
gactgtgcgcacagcaacggccagtgtgggcaactgtgcctcgccatccctggaggccac
cgctgcagctgcgcctcacactacacgctggaccccagcagccgtaactgcagcccgccc
tccaccttcttgctgttcagccagaaattcgccatcagccgcatgattcccgatgaccag
cgcagcccggacctcatcctgcccctgcacgggctgaggaacgtcagggccatcggctat
gacccactggacaagttcatctactgggtggacgggcgtcagaacatcaagcgagccaag
gatgacggcacccagccctctgttctgacctcttccggccaaagcctgagcccagacaga
cagccacatgacctcagcattgacatctacagccggacactgttctggacctgtgaggcc
accaacaccatcaatgtccaccgtctggatggggaggccatgggtgtggtccttcggggg
gaccgtgacaagccaagggccattgctgtcaatgctgaacgagggtacctgtacttcacc
aacatgcaggaccacgcggccaagatcgagcgcgctgccctagacggcactgaacgcgag
gtcctcttcaccacgggccttatccgcccagtggcccttgtggtagacaatgctctgggc
aagctcttctgggtagatgcagacctgaagcgtattgaaagctgtgacctgtcaggggcg
aaccgcctgaccctggaggactccaacatcgtgcagccggtgggcttgacggtgcttggc
aggcacctctactggatagatcgccagcaacagatgattgagcgtgtggagaagactact
ggggacaagcggactcgtgtccagggccgcgtcacccacctgacaggcatccatgctgtg
gaggaagtcagcctggaggagttctcagcccatccatgtgcccgggataacggcggctgc
tcccatatctgcattgccaagggtgacggaacgcctcggtgctcatgccctgcccacctt
gtgctcctgcagaacctgctgacttgtggtgaacctcccacctgctcccctgaccagttt
acatgtgccaccggtgagatagactgcatccccggagcctggcgctgtgatggctttcct
gagtgtgccgaccagagtgacgaggagggctgccccgtgtgctcagcctcccagttcccc
tgtgcacgcggccagtgcgtggacctgcgcctacgctgtgatggtgaagccgactgccag
gaccgctcagatgaagccaactgtgatgctgtgtgcctgcccaaccagttccggtgcgcc
agtggccagtgcgtcctcatcaagcagcagtgcgactccttccccgactgcgccgatggc
tccgatgagctcctatgtgaaatcaccaacccaccatctgacgacaccccagcccacagc
agcgccatcgggcccatcattggcatcatcctgtcgctcttcgtcatgggcggggtctac
tttgtctgccagcgtgtgatgtgccagcgctacacgggggccaatgggccctttccccat
gaatatgtcagtggaacccctcatgtacctctcaacttcattgctccaggcggctcgcag
catggtcccttcccaggcatctcttgcagcaagtcaatgatgagctccatgaacctggtt
gggggccggggcggcgtgcccctctatgaccggaaccacgtcaccggggcctcgtccagc
agctcatccagcacaaaagccacgctgtatccaccgatcctgaacccaccgccatcccct
gccacagatccctccctgtacaacatggacatgttctattcttcaaacattccggccacc
accagaccgtacaggccctacatcattcgtggtatggcacccccaacaacgccttgcagc
acagatgtgtgcgacagcgactacagcaccagccgctggaagaccagcaagtactacctg
gatttgaactcggactcagacccttacccgcccccacccacaccccacagtcagtacctc
tcggcggaagacagctgcccgccctcacctgtcaccgagcggagctactgtcacctcttt
cccccacctccgtccccctgcacggactcatcctga

DBGET integrated database retrieval system