KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738044Help
Entry
103738044         CDS       T03372                                 

Gene name
Pten
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04068  FoxO signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04115  p53 signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04510  Focal adhesion
ngi04931  Insulin resistance
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05222  Small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05230  Central carbon metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103738044 (Pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103738044 (Pten)
   04070 Phosphatidylinositol signaling system
    103738044 (Pten)
   04071 Sphingolipid signaling pathway
    103738044 (Pten)
   04151 PI3K-Akt signaling pathway
    103738044 (Pten)
   04150 mTOR signaling pathway
    103738044 (Pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103738044 (Pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    103738044 (Pten)
   04218 Cellular senescence
    103738044 (Pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103738044 (Pten)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103738044 (Pten)
   05206 MicroRNAs in cancer
    103738044 (Pten)
   05230 Central carbon metabolism in cancer
    103738044 (Pten)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103738044 (Pten)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103738044 (Pten)
   05214 Glioma
    103738044 (Pten)
   05218 Melanoma
    103738044 (Pten)
   05215 Prostate cancer
    103738044 (Pten)
   05213 Endometrial cancer
    103738044 (Pten)
   05224 Breast cancer
    103738044 (Pten)
   05222 Small cell lung cancer
    103738044 (Pten)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103738044 (Pten)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103738044 (Pten)
   05165 Human papillomavirus infection
    103738044 (Pten)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103738044 (Pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103738044 (Pten)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103738044 (Pten)
    3.1.3.48  protein-tyrosine-phosphatase
     103738044 (Pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     103738044 (Pten)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    103738044 (Pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 103738044
NCBI-ProteinID: XP_008836075
LinkDB All DBs
Position
Un
AA seq 403 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI
DSICSIERADDDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaacattatagctatgggatttcctgcagaa
agacttgaaggtgtatacaggaacaatatcgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgaaagacattatgacaccgccaaa
tttaactgcagagttgcacaatatccttttgaagaccataacccaccacagctagaactt
atcaaacccttttgtgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagctggaaagggacggactggtgtaatgatttgcgcatatttattg
catcggggcaaatttttaaaggcacaagaggccctagatttctatggggaagtaaggacc
agagacaaaaagggagtaactattcccagtcagaggcgctatgtgtattattatagctac
ctgttaaagaatcatctggattatagaccagtggcactgttgtttcacaagatgatgttt
gaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtctgccagcta
aaggtgaagatatattcctccaattcaggacccacacgacgggaagacaagttcatgtac
tttgagttcccccagccgttgcctgtgtgtggtgacatcaaagtagagttcttccacaaa
cagaacaagatgctaaaaaaggacaaaatgtttcacttttgggtaaatacgttcttcata
ccaggaccagaggaaacctcagaaaaagtagaaaatgggagtctctgtgatcaggaaatt
gacagcatttgcagtatagaacgtgcagatgatgacaaggaatatctagtgcttacctta
acaaaaaacgatcttgacaaagcaaataaagacaaagccaaccgatatttttctccaaat
tttaaggtgaaactatactttacaaaaacagtggaggagccatcaaatccagaggctagc
agttcaacttctgtaacgccagatgttagtgacaatgaacctgatcattatagatattct
gacaccactgactctgatccagagaatgaacctttcgatgaagatcagcattcacaaatt
acaaaagtctga

DBGET integrated database retrieval system