KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738305
Entry
103738305         CDS       T03372                                 

Gene name
Gfap
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103738305 (Gfap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103738305 (Gfap)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ngi04812]
    103738305 (Gfap)
Membrane trafficking [BR:ngi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    103738305 (Gfap)
Cytoskeleton proteins [BR:ngi04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     103738305 (Gfap)
SSDB
Motif
Pfam: Filament Filament_head DUF1664 TPR_MLP1_2 GAS
Other DBs
NCBI-GeneID: 103738305
NCBI-ProteinID: XP_008836434
LinkDB
Position
Un
AA seq 430 aa
MERRRITSARRSYASSETVVRGLGPSRHLGTIPRFSLARMPPPLPTRVDFSLAGALNAGF
KETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRE
LRLRLDQLTANSARLEVERDNMAQDLNTLRQKLQDETNLRLEAENNLATYRQEADEATLA
RLDLERKIESLEEEIQFLRKIHEEEVRELQEQRAQQQVHVEMDVAKPDLTAALREIRTQY
EAVATSNMQEAEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGT
NESLERQMREQEERHAREMAGYQEALARLEEEGQSLKDQMAHHLQEYQDLLNVKLALDIE
IATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIK
ESKQEHKDVM
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagcgaagacgcatcacttctgctcgtcgctcctatgcctcctcagagacggtggtc
aggggcctgggtcccagccgccacctgggtaccatcccccgcttctccctggctcgaatg
ccccctccactccctactagggtggacttttccttggctggggcactcaatgctggcttc
aaggagaccagggccagtgagcgagctgagatgatggagctgaatgatcgctttgccagc
tatatcgagaaggtccgcttcctagaacagcaaaacaaggcactagcagctgagttaaac
cagctccgagccaaggagcccaccaagctggccgatgtctatcaggcagaacttcgggag
ctgaggctgaggcttgatcaacttactgccaacagtgcccggttggaggtggaaagggac
aatatggcacaagacctcaacaccctgaggcagaagctccaggatgaaaccaacctgagg
ctggaggcagagaacaacctggccacctacagacaggaggcagatgaagccaccctggcc
cgtctggatctggagaggaagattgagtcactggaggaggagatccagttcttgaggaag
atccatgaggaggaagtacgagaactccaggagcaacgggcccaacagcaggtccatgtg
gagatggatgtggccaagccagatctcacagcagccctgagagagattcgcacacaatat
gaggctgtggccaccagcaacatgcaagaagcagaggagtggtataggtccaagtttgca
gacctcacagacgctgcttcccgcaacgcagagctgctccgccaggccaagcacgaggcc
aacgactatcggcgccagctgcaggccttgacctgcgacctggagtccttgcgtggcaca
aacgagtccctggagaggcaaatgcgtgagcaagaggagcgccacgcgagggagatggca
ggttaccaggaggcgctggcccggctggaggaggagggacaaagcctcaaggaccagatg
gcccaccacctgcaggagtaccaggacctactcaacgtcaagctggccctggacatcgag
atcgccacctacagaaagctgctggagggcgaggagaaccgcatcaccattcctgtgcag
accttctccaacctgcagatccgagaaaccagcctggacaccaagtccgtgtcagagggc
cacctcaagaggaacatcgtggtaaagacagtggagatgcgggatggtgaggtcattaag
gagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system