KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738320Help
Entry
103738320         CDS       T03372                                 

Gene name
Map3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04210  Apoptosis
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04668  TNF signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05166  Human T-cell leukemia virus 1 infection
ngi05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103738320 (Map3k14)
   04064 NF-kappa B signaling pathway
    103738320 (Map3k14)
   04668 TNF signaling pathway
    103738320 (Map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103738320 (Map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103738320 (Map3k14)
   04660 T cell receptor signaling pathway
    103738320 (Map3k14)
   04672 Intestinal immune network for IgA production
    103738320 (Map3k14)
  09158 Development
   04380 Osteoclast differentiation
    103738320 (Map3k14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    103738320 (Map3k14)
   05169 Epstein-Barr virus infection
    103738320 (Map3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103738320 (Map3k14)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103738320 (Map3k14)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: STE group
  Other
   103738320 (Map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 103738320
NCBI-ProteinID: XP_008836467
LinkDB All DBs
Position
Un
AA seq 939 aa AA seqDB search
MAVMEVACPGAPCSAVGQQKELTKAKEKTPSLGKKQSCIYKLEAVEKSPVFCGKWEVLND
VITKGTAKEGSEGGPSAISIIAQAECENSQEFSPTFSERIFIAGSQQYSQSESLDQIPNN
VAHATEGKMAQVCRKGKRRSKARKKRKKKSKSLAQAGVALAKPLPRTPEQESCTVPIQED
ESPLGNLYARNVPQFTKPLKEPGFSHLCFKKRGEGLRPALPRPELHKLISPLQCLNHVWK
LHHPQDIGPLPHSTHPFPYSGLPHPFPFHPLKPWKPHPLESFLDKLAGVSSQQPLPGPHL
SKLAFGNSQKPLSSSHLESSYPSRDVHEKFPVEEYLVHALQGSVSSGQAHGLASLAKTWS
AGSSKPQRLSPETEDNEGVLLTEKLKPVDYEYREEVHWVTHQPRLGRGSFGEVHRMKDKQ
TGFQCAVKKVRVEVFRAEELMACAGLTSPRIVPLYGAVREGLWINIFMELLEGGSLGQLI
KQKGCLPEDRALYYLGQALEGLEYLHIRRILHGDVKADNVLLSSDGSRAALCDFGHALCL
QPDGLGKSLLTGDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFR
GPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRASAMELRGKVSQALQQVGGL
KSPWKGEYKEPRPPPPDQATCHQTLHAPPREHSPAKDSTDGSPKPQPPLLPEPPEQNKAP
ALNLSKEESGMWEPLPLSSLDLTPVKSPSSPERRATFPELELQQLEIELFLNSLSQPFSL
EEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWNSQAEARSSSCNMVLAR
GRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPATAFSLVTKDGQP
VRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaagtggcctgcccaggcgccccttgctcagctgttgggcagcagaaa
gagctcaccaaagccaaggagaagacaccatcactaggaaagaagcagagctgcatctac
aaacttgaggctgtggagaagagccctgtgttctgtgggaagtgggaggtcctgaatgac
gtgattaccaaaggcacagcgaaggaaggttctgagggcgggccttccgcaatctccatc
attgcccaggctgaatgtgagaatagccaagagttcagccctaccttttcagagcgcatt
ttcatcgcaggatcgcagcagtacagtcagtctgagagtcttgatcaaatccccaacaat
gtggcccatgcaactgagggcaaaatggcccaagtgtgccggaagggaaagcgtcgcagc
aaagcccggaagaaacggaagaagaagtccaagtccctggcccaggcaggagtggcctta
gccaaacccctgcccagaacccctgagcaagagagctgcacggtcccaatacaggaagat
gagtctccattaggcaacctctatgccagaaatgttccccagttcactaagcctctgaaa
gaaccaggctttagtcacctctgctttaagaaacgaggagagggcctgcggccagcgctg
cctcgaccggaactccacaaactgatcagccccttgcagtgtctaaaccatgtgtggaaa
ctccaccacccccaggacataggccccctgccccattccactcaccctttcccctatagc
ggactgccccatcctttcccattccaccctctcaaaccctggaaaccccatcctctggaa
tctttccttgacaaactagctggcgtaagtagccagcagcccctccctggcccacacctg
agcaagctggcctttggaaacagtcagaagcccctgagcagctcacatctggaatctagc
tacccatctcgtgatgtccatgagaagtttcctgtggaggaatacttggtacatgcacta
caagggagtgtgagctcaggccaggcacatggcctggccagcctggctaagacttggtca
gcaggcagctctaagccccagagactcagccctgaaactgaggacaacgagggagtcttg
cttacagagaaactcaagccagtggattatgagtaccgagaagaggtccattgggtgaca
caccagccacgtttgggcagaggctccttcggtgaggtccacagaatgaaggacaagcag
acaggcttccagtgtgctgtcaaaaaggtgcgggtcgaagtgtttcgggcagaggaactg
atggcctgtgctggactgacctcaccccgaattgtacctctctatggagctgtgagagaa
ggtctatggatcaacatcttcatggagctgctagaaggtggctcactaggccagctcata
aagcaaaagggctgtctgccagaagaccgggccctttactaccttggccaggccctggag
gggctagaatatctccatatacgaaggattctgcatggtgatgtcaaagctgacaatgtg
ctcctgtccagcgatgggagccgagcagccctctgtgactttggccatgccttgtgcctg
caaccagatggcctagggaaatccttactcacaggtgactacatccctggcacagaaaca
cacatggccccagaagtggtgatggggaagccctgtgatgccaaggtggacatctggagc
agctgctgcatgatgctccacatgctcaatggctgccatccctggactcagtacttccga
ggcccactctgcctcaagattgccagtgaacctccacctgtacgggagattccaccctcc
tgtgcacccctcacagcccaagccatccaagaggggctcaggaaagagcctatccaccga
gcatctgccatggagctccgagggaaggtgagccaggcactgcagcaagtgggaggcctg
aaaagcccttggaagggcgaatacaaagaaccgagacctccacccccagaccaagccact
tgccaccagaccctgcatgccccaccaagggagcactcaccagccaaggacagcacagat
gggtcccctaaacctcagcctcctctactgccagaacctccagaacagaacaaggcccca
gccctgaacctgagcaaagaagagtctggcatgtgggaacccctgcctctgtcctcactg
gacctgacccctgtcaagagccccagctccccagagcggagggcaaccttcccagagctg
gaactacagcagctggagatagaactgtttctcaacagcctgtcccagcctttttctctg
gaggaacaggaacagattctctcatgcctcagcattgacagcctctcactgtcagatgac
agtgaaaagaacccatcaaaggcctctcagagctcaagagacaccctgagttccggcgta
cactcatggaacagccaggccgaggcacggagctccagctgcaacatggtgctggcccgg
ggtcggcccactgacaccccaagctacttcaatggtgtcaaagtccaaatacagtctctc
aatggtgaacaccttcacatccgggaattccaccgggtcaaggtgggagacattgcaact
ggcatcagcagccagatcccagccacagccttcagcttggtgaccaaagatggacagcct
gttcgctatgacatggaggtgccagactcgggcatcgacctgcagtgcaccctggcccct
gatggcagctttgcatggagctggagggtcaaacatggccagctggagaaccgaccctag

DBGET integrated database retrieval system