KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738795
Entry
103738795         CDS       T03372                                 

Gene name
Bad
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04140  Autophagy - animal
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04370  VEGF signaling pathway
ngi04510  Focal adhesion
ngi04722  Neurotrophin signaling pathway
ngi04910  Insulin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05165  Human papillomavirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103738795 (Bad)
   04014 Ras signaling pathway
    103738795 (Bad)
   04370 VEGF signaling pathway
    103738795 (Bad)
   04024 cAMP signaling pathway
    103738795 (Bad)
   04022 cGMP-PKG signaling pathway
    103738795 (Bad)
   04151 PI3K-Akt signaling pathway
    103738795 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103738795 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    103738795 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103738795 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103738795 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103738795 (Bad)
   04919 Thyroid hormone signaling pathway
    103738795 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103738795 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103738795 (Bad)
   05203 Viral carcinogenesis
    103738795 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103738795 (Bad)
   05212 Pancreatic cancer
    103738795 (Bad)
   05225 Hepatocellular carcinoma
    103738795 (Bad)
   05221 Acute myeloid leukemia
    103738795 (Bad)
   05220 Chronic myeloid leukemia
    103738795 (Bad)
   05218 Melanoma
    103738795 (Bad)
   05211 Renal cell carcinoma
    103738795 (Bad)
   05215 Prostate cancer
    103738795 (Bad)
   05213 Endometrial cancer
    103738795 (Bad)
   05223 Non-small cell lung cancer
    103738795 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103738795 (Bad)
   05014 Amyotrophic lateral sclerosis
    103738795 (Bad)
   05020 Prion disease
    103738795 (Bad)
   05022 Pathways of neurodegeneration - multiple diseases
    103738795 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103738795 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103738795 (Bad)
   05161 Hepatitis B
    103738795 (Bad)
   05160 Hepatitis C
    103738795 (Bad)
   05162 Measles
    103738795 (Bad)
   05168 Herpes simplex virus 1 infection
    103738795 (Bad)
   05165 Human papillomavirus infection
    103738795 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103738795 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103738795 (Bad)
   01524 Platinum drug resistance
    103738795 (Bad)
   01522 Endocrine resistance
    103738795 (Bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 103738795
NCBI-ProteinID: XP_008837165
LinkDB
Position
Un
AA seq 202 aa
MGTPKRPSLAPAHARGVRKSESSIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDCSSA
ERSLGPVLAGDQSGLCPAPGLLGDTSHQQRGATNSSHHGGAGAETRSRHSSYPAGTDEDE
RIEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSS
SWTRIFQSWWDRNLGKGGSAPS
NT seq 609 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagaggccctcgctagctcctgcacacgcccgaggcgtgaggaagtct
gagtccagcatccggagcctggggagcgacgcgggaggaaggcggtggcgaccagcagcc
cagagcatgttccagatcccagagtttgagccgagtgagcaggaagactgcagctctgca
gaaaggagcctggggcctgtcctggctggggaccagtcaggtctctgcccggccccaggt
ctcctaggggacaccagtcaccagcagaggggtgcgaccaacagcagccatcatggaggc
gctggggctgagacccggagtcgtcacagttcgtaccccgcggggacggacgaggatgaa
aggatcgaggaggaactcagccccttccggggccgctcgcgctcggctccccccaacctc
tgggccgcacagcgctacggccgcgagctccggaggatgagtgacgagttccagggctcc
ttcaagggccttcctcgcccaaagagcgcgggcacggcgacacagatgcggcaaagctcc
agctggacgcgaatcttccagtcctggtgggatcgaaacttggggaaaggaggctccgcc
ccctcttaa

DBGET integrated database retrieval system