KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738854
Entry
103738854         CDS       T03372                                 

Gene name
Hes1
Definition
(RefSeq) hes family bHLH transcription factor 1
  KO
K06054  hairy and enhancer of split 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03460  Fanconi anemia pathway
ngi04330  Notch signaling pathway
ngi04950  Maturity onset diabetes of the young
ngi05165  Human papillomavirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    103738854 (Hes1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103738854 (Hes1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103738854 (Hes1)
  09162 Cancer: specific types
   05224 Breast cancer
    103738854 (Hes1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    103738854 (Hes1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103738854 (Hes1)
   05165 Human papillomavirus infection
    103738854 (Hes1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103738854 (Hes1)
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103738854 (Hes1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103738854 (Hes1)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     103738854 (Hes1)
SSDB
Motif
Pfam: Hairy_orange HLH
Other DBs
NCBI-GeneID: 103738854
NCBI-ProteinID: XP_008837254
LinkDB
Position
Un
AA seq 281 aa
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFA
HSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 846 nt   +upstreamnt  +downstreamnt
atgccagctgatattatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaagtcatcaaagccg
atcatggagaaaaggcgaagagcaagaataaatgaaagtctgagccagctgaaaacactg
attttggatgctcttaagaaagatagctcccggcattccaagctggagaaggcggacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgtgcgcagatgaccgccgcgctg
agcaccgacccgagcgtgttggggaagtaccgcgccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgcgagggcgttaacaccgaggtgcgcactcggctgctg
ggccacctggccaactgcatgacccagatcaacgccatgacctaccccgggcagccgcac
cccgccttgcaggcgccgccgccacccccgcctggacccggcggcccccagcacgcgccg
ttcgcgccgccgccgccaccgctcgtgcctatccccgggggcgcggcgccccctcccggc
agcgcaccctgcaagttgggcagccaggctggagaggcggccaaggtgttcggaggcttc
caggtggtgccagctcctgacggccagtttgccttcctcatccccaatggggcatttgct
cacagcggcccggtcatccccgtctacaccagcaacagcgggacctcggtgggtcctaac
gcagtgtcgccttccagcggcccctcgctcactgcggactccatgtggaggccgtggagg
aactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749777
Entry
103749777         CDS       T03372                                 

Gene name
Hes5
Definition
(RefSeq) hes family bHLH transcription factor 5
  KO
K06055  hairy and enhancer of split 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04330  Notch signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103749777 (Hes5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103749777 (Hes5)
  09162 Cancer: specific types
   05224 Breast cancer
    103749777 (Hes5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103749777 (Hes5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103749777 (Hes5)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103749777 (Hes5)
SSDB
Motif
Pfam: HLH Hairy_orange
Other DBs
NCBI-GeneID: 103749777
NCBI-ProteinID: XP_008850874
LinkDB
Position
Un
AA seq 166 aa
MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFAAATSPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAPAAPAKETPAPGAAPLPARSSTKTAATAAATRQPACGLWRPW
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctccaagcaccgtggcggtggagatgctcagtcccaaggagaaaaaccgactgcgc
aagccggtagtggagaagatgcgccgggaccgcatcaacagcagcatcgagcagctgaag
ctgctgctggagcaggagttcgccaggcaccagcccaactccaagctggagaaggccgac
atcctggaaatggcggtcagctacctgaagcacagcaaagccttcgccgcggccaccagc
cccaagagcctgcaccaggactacagcgagggctactcgtggtgcctgcaggaggctgtg
cagttcctgaccctgcacgccgccagcgacacgcagatgaagctgctgtaccactttcag
cggccgccagcgcccgccgcacctgctaaggagacccccgcaccgggtgccgcgccccta
cccgcgcgctcctccaccaagacggccgccaccgctgccgccactcgccaacccgcctgt
ggcctctggcggccctggtga

DBGET integrated database retrieval system