KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739419Help
Entry
103739419         CDS       T03372                                 

Gene name
Tgm1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103739419 (Tgm1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103739419 (Tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core Trypan_PARP Adeno_E1A
Motif
Other DBs
NCBI-GeneID: 103739419
NCBI-ProteinID: XP_008838026
LinkDB All DBs
Position
Un
AA seq 811 aa AA seqDB search
MEGPRADVGRWGGNRWQPPTTPSPEPEPEPEPEPDRRSRRGGGGRSFWARCCGCCSCRNR
GDDDWGPEPSGSRSRGSSSRGGRRPESRGGGVNAAGDGTIREGMLVVTGVDLLSSRSDQN
RREHHTDEFEYEELIVRRGQPFHIILFLNREYESSDRIALELLIGNNPEVGKGTHVIIPV
GKGSNEGWKAQVTKASEHNLNLRVHTSPNAIIGKFQFTVRTHSEAGEFQLPFDPRNEIYI
LFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYIL
DRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSY
LRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLE
HLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLV
YMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAVSSNMREEITHIYK
HPEGSEAERKAVETAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLTVSVVLTNRGS
SRRTVKLHLYLSVTFYTGVTGSTFKETKKEVALAPGASDRVTMPVAYKEYRPHLVDQGAM
LLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFRNPLPITLTNVV
FRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVD
VAPASGGRGFSDAGGNSHSGETIPMASRGGA
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcctcgcgcagacgtgggccgctggggcgggaaccgctggcagccccctacc
acaccttcgccagagccagagccagagccagagccagagccagacaggcgctcccgcaga
gggggaggaggccgctccttctgggcccgctgctgcggctgctgctcatgccggaacagg
ggcgacgatgactggggtcctgagccctccggctccaggagtcgagggtccagctctcga
gggggccgaagacccgagtcccggggcggtggtgtaaacgcagctggagacggcaccatc
cgagagggcatgctggtggtgactggtgtggatctgctgagttcacgctcagaccagaac
cgacgagaacaccacacagatgagttcgagtacgaagagctgattgtgcgccgtgggcaa
cccttccacataatcctcttcctgaaccgggaatatgagtcctctgatcgcatcgcccta
gagctgcttattggaaacaaccccgaggtgggcaagggcacccacgtgatcattccagtg
ggcaagggaagtaatgagggatggaaggcacaggtgacaaaagccagtgaacataatttg
aacttacgggttcacacctcccctaatgccatcatcggaaagtttcagttcactgtccgc
acacactcagaggctggagagttccagttgcccttcgatcctcgaaacgagatctacatc
ctctttaatccctggtgtccagaggacatcgtgtatgtggaccatgaggactggcggcaa
gaatacgtgcttaatgagtctgggagaatttactatggaacagaggcacagattggtgag
cggacctggaactatggccagtttgaccatggggtgctggatgcctgcttgtacatcctg
gatcgaagagggatgccatatggaggccgtggagatccagtcagtgtctcccgggtcatc
tctgccatggtgaactccctggatgacaatggagtcctgattgggaactggtctggcgat
tactctcgaggcaccaacccctcagcgtgggtgggcagcgtggagatcctgcttagctac
ctacgtactggctattccgtcccctatggccaatgctgggtctttgctggcgtgaccacc
acagtgttgcgatgcctgggcctcgctacccgtactgtcaccaatttcaactctgcacac
gacacagacacatccctcactatggacatctactttgatgagaacatgaagccacttgag
catctgaaccatgattctgtttggaacttccatgtgtggaatgactgctggatgaagagg
ccagatctaccctcaggctttgatgggtggcaggttgtagatgccacaccccaggagaca
agcagtggtatcttctgctgtggtccctgctccgtggagtccatcaagaatggcttagtc
tacatgaagtatgacacacccttcatttttgctgaggtaaacagtgataaagtatactgg
cagcgacaagatgacggcagcttcaagattgtgtatgtggaggaaaaagccatcggcaca
ctcattgtcacaaaagcagtcagctccaacatgcgagaggaaatcacccacatctataag
cacccagaaggctcagaagcagagcggaaggccgtggagacagcagctgcccatggcagc
aaacctaatgtgtatgccacccgggattctgctgaggacgtagcaatgcaggtggaagcc
caggacgctgtgatgggacaggatctgacggtctctgtggtgctgaccaatcgaggcagt
agccgccgcactgtgaaattgcacctctacctctctgtcacgttttacaccggtgtcact
gggtctaccttcaaggagaccaagaaggaagtggcactggcaccaggggcctcggaccgt
gttaccatgcctgtggcttacaaggaatatcggccccacctcgtggaccaaggcgcaatg
ctgctcaacgtctcgggccatgtcaaggagagtgggcaggtactggccaagcagcacacc
ttccgtttgcgcacccctgacctctccctcacgttactgggagcagcagtggtcggccag
gagtgtgaagtacagattgtgttcaggaaccccctgcccatcaccctcaccaacgttgtc
ttccggctcgaaggctccgggttacagagacccaaggtcctcaacgttggggacatcggg
ggtaatgagacagtcacactgcgccagacatttgtgcctgtgcgaccaggcccccgccag
ctcattgccagcttggacagcccacagctctcccaggtacatggtgtcatccaagtggac
gtggccccagcctctggaggcaggggtttctcagatgctggaggcaacagtcactcaggg
gagaccatacctatggcatctcgaggtggagcttag

DBGET integrated database retrieval system