KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739430
Entry
103739430         CDS       T03372                                 

Gene name
Irf9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi05160  Hepatitis C
ngi05162  Measles
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739430 (Irf9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103739430 (Irf9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103739430 (Irf9)
   04625 C-type lectin receptor signaling pathway
    103739430 (Irf9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103739430 (Irf9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103739430 (Irf9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103739430 (Irf9)
   05171 Coronavirus disease - COVID-19
    103739430 (Irf9)
   05164 Influenza A
    103739430 (Irf9)
   05162 Measles
    103739430 (Irf9)
   05168 Herpes simplex virus 1 infection
    103739430 (Irf9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103739430 (Irf9)
   05169 Epstein-Barr virus infection
    103739430 (Irf9)
   05165 Human papillomavirus infection
    103739430 (Irf9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103739430 (Irf9)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    103739430 (Irf9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 103739430
NCBI-ProteinID: XP_008838048
LinkDB
Position
Un
AA seq 407 aa
MASGKPRCTRKLREWVVQQVESRQFPGVCWEDAAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGNIGGPAVWKTRLRCALNKSPEFEEVPKRGRMDVAEPYKVYRLLKPRTL
PAKSGIQNSSSKQSFSSVSPKREENVGIKNCTLSYSCPHDSPDNEEVRANGVTDHSDSGN
SSSPEPQEVTVKTEATIQEDPVSMEHPLPLNSDYSLLLTFIYCGRVVGEAHVHSLDCRLV
AEPSGSESSMEQVVFPKPDPLEPTQRLLSQLERGILVASNSRGLFVQRLCSIPISWNAPE
APPGPGPHLLPSNKCVELFRTTSFYRDLVRYFHGQGPPPKFQATLHFWEEIPGSNHTQQN
LITVQMEQAFARDLLKEIPEEQAAALFLVQSPEHSPATLPLCSSGLR
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggcatcaggcaagccacgctgtacccgaaagctccgggaatgggtggtgcagcaagtg
gagagtaggcagttcccaggggtgtgctgggaagatgcagccaagaccatgttccgaatt
ccctggaagcatgcaggcaaacaggacttccgggaagaccaggatgctgccttcttcaag
gcttgggcaatatttaagggaaagtacaaggaggggaacataggaggccctgctgtctgg
aaaactcgcctacgctgtgccctcaacaagagtcctgaatttgaggaggttcctaagaga
ggccgtatggatgttgctgagccctacaaagtatatcggctgctgaaaccaagaaccctc
cctgccaagtcaggaatccagaactcctcatccaagcaatccttcagttctgtgtcaccc
aagagggaagagaatgtgggcatcaagaactgcacgctcagttattcctgtcctcacgac
tcccctgataatgaggaggtgagggccaatggggtcacagaccactcagacagtgggaac
agcagcagtcctgaaccacaggaagttactgtcaaaactgaagccaccattcaagaggac
ccagtgtccatggaacatccgcttcctctgaactcagactactcactgctgctcaccttc
atctactgtgggcgcgtggtgggtgaggcccacgtgcacagcctggactgccgccttgtg
gctgaaccctccggctccgagagcagcatggagcaggtggtgtttcccaaacctgatcca
ctggagcccacccagcgcctgctgagccaacttgagagaggtatcctggtagccagtaac
tccagaggcctctttgtacagcgtctttgctccatccccatctcgtggaatgcacctgag
gccccacctgggccaggcccacatctactgcccagcaataagtgtgtggagctcttcagg
actacctctttctacagagatttggtccggtacttccatggccaaggtcccccacccaag
ttccaggccacattgcatttctgggaggagattcctggctccaaccatacacaacagaat
cttatcacagtgcaaatggaacaggcctttgcccgagatttactgaaggagattccagag
gagcaggcagctgctttgttcctggtacagagcccagaacactcacctgccactttacct
ctctgttcctctggtctccgttga

DBGET integrated database retrieval system