KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739652
Entry
103739652         CDS       T03372                                 

Gene name
Cdkn1a
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04630  JAK-STAT signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103739652 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    103739652 (Cdkn1a)
   04066 HIF-1 signaling pathway
    103739652 (Cdkn1a)
   04068 FoxO signaling pathway
    103739652 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    103739652 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103739652 (Cdkn1a)
   04115 p53 signaling pathway
    103739652 (Cdkn1a)
   04218 Cellular senescence
    103739652 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103739652 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    103739652 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739652 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    103739652 (Cdkn1a)
   05206 MicroRNAs in cancer
    103739652 (Cdkn1a)
   05205 Proteoglycans in cancer
    103739652 (Cdkn1a)
   05203 Viral carcinogenesis
    103739652 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103739652 (Cdkn1a)
   05212 Pancreatic cancer
    103739652 (Cdkn1a)
   05225 Hepatocellular carcinoma
    103739652 (Cdkn1a)
   05226 Gastric cancer
    103739652 (Cdkn1a)
   05214 Glioma
    103739652 (Cdkn1a)
   05216 Thyroid cancer
    103739652 (Cdkn1a)
   05220 Chronic myeloid leukemia
    103739652 (Cdkn1a)
   05217 Basal cell carcinoma
    103739652 (Cdkn1a)
   05218 Melanoma
    103739652 (Cdkn1a)
   05211 Renal cell carcinoma
    103739652 (Cdkn1a)
   05219 Bladder cancer
    103739652 (Cdkn1a)
   05215 Prostate cancer
    103739652 (Cdkn1a)
   05213 Endometrial cancer
    103739652 (Cdkn1a)
   05224 Breast cancer
    103739652 (Cdkn1a)
   05222 Small cell lung cancer
    103739652 (Cdkn1a)
   05223 Non-small cell lung cancer
    103739652 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103739652 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103739652 (Cdkn1a)
   05161 Hepatitis B
    103739652 (Cdkn1a)
   05160 Hepatitis C
    103739652 (Cdkn1a)
   05163 Human cytomegalovirus infection
    103739652 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103739652 (Cdkn1a)
   05169 Epstein-Barr virus infection
    103739652 (Cdkn1a)
   05165 Human papillomavirus infection
    103739652 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103739652 (Cdkn1a)
   01522 Endocrine resistance
    103739652 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103739652
NCBI-ProteinID: XP_008838294
LinkDB
Position
Un
AA seq 162 aa
MSDPGDARPVPYRSKVCRRLFGPVDSEELRRDCDALMASCLQEARERWNFDFVTETPLEG
NFAWEPVRGLGLPKLYLTPGCRGGRDDLGGDKRPSTSALLQGPALEDHVDLSLSCTLVSH
SPERPEDSPGGPGTSQGRKRRQTSMTDFYHSKRRLVFSKRKP
NT seq 489 nt   +upstreamnt  +downstreamnt
atgtccgatccaggagatgcccgtccagttccatacaggagcaaggtgtgtcgccgtctc
tttggccccgtggacagtgaggaattgcgccgagactgtgatgccctcatggccagctgc
ctccaggaggcccgggaacggtggaacttcgactttgtgacggagactccgctggagggc
aacttcgcctgggagcccgtacggggtttggggctgcccaagctctacctgacccccggc
tgcaggggtggccgtgacgacctgggaggggacaagaggcccagcacctctgccctgctt
cagggaccagctctggaggaccatgtggacctgtcgctgtcctgcaccctggtgtctcac
tcccctgagaggcctgaggactccccaggtgggcccggaacctctcagggccgaaaacgg
cgtcagactagcatgacagatttctaccactccaagcgccggctggtcttctctaagagg
aagccctaa

DBGET integrated database retrieval system