KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739696
Entry
103739696         CDS       T03372                                 

Gene name
Itpr3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04114  Oocyte meiosis
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05014  Amyotrophic lateral sclerosis
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05163  Human cytomegalovirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103739696 (Itpr3)
   04020 Calcium signaling pathway
    103739696 (Itpr3)
   04070 Phosphatidylinositol signaling system
    103739696 (Itpr3)
   04022 cGMP-PKG signaling pathway
    103739696 (Itpr3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103739696 (Itpr3)
   04210 Apoptosis
    103739696 (Itpr3)
   04218 Cellular senescence
    103739696 (Itpr3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103739696 (Itpr3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103739696 (Itpr3)
   04621 NOD-like receptor signaling pathway
    103739696 (Itpr3)
   04625 C-type lectin receptor signaling pathway
    103739696 (Itpr3)
  09152 Endocrine system
   04911 Insulin secretion
    103739696 (Itpr3)
   04922 Glucagon signaling pathway
    103739696 (Itpr3)
   04929 GnRH secretion
    103739696 (Itpr3)
   04912 GnRH signaling pathway
    103739696 (Itpr3)
   04915 Estrogen signaling pathway
    103739696 (Itpr3)
   04921 Oxytocin signaling pathway
    103739696 (Itpr3)
   04935 Growth hormone synthesis, secretion and action
    103739696 (Itpr3)
   04918 Thyroid hormone synthesis
    103739696 (Itpr3)
   04928 Parathyroid hormone synthesis, secretion and action
    103739696 (Itpr3)
   04924 Renin secretion
    103739696 (Itpr3)
   04925 Aldosterone synthesis and secretion
    103739696 (Itpr3)
   04927 Cortisol synthesis and secretion
    103739696 (Itpr3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103739696 (Itpr3)
  09154 Digestive system
   04970 Salivary secretion
    103739696 (Itpr3)
   04971 Gastric acid secretion
    103739696 (Itpr3)
   04972 Pancreatic secretion
    103739696 (Itpr3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103739696 (Itpr3)
   04725 Cholinergic synapse
    103739696 (Itpr3)
   04728 Dopaminergic synapse
    103739696 (Itpr3)
   04726 Serotonergic synapse
    103739696 (Itpr3)
   04720 Long-term potentiation
    103739696 (Itpr3)
   04730 Long-term depression
    103739696 (Itpr3)
   04723 Retrograde endocannabinoid signaling
    103739696 (Itpr3)
  09157 Sensory system
   04742 Taste transduction
    103739696 (Itpr3)
   04750 Inflammatory mediator regulation of TRP channels
    103739696 (Itpr3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103739696 (Itpr3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103739696 (Itpr3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103739696 (Itpr3)
   05012 Parkinson disease
    103739696 (Itpr3)
   05014 Amyotrophic lateral sclerosis
    103739696 (Itpr3)
   05017 Spinocerebellar ataxia
    103739696 (Itpr3)
   05020 Prion disease
    103739696 (Itpr3)
   05022 Pathways of neurodegeneration - multiple diseases
    103739696 (Itpr3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103739696 (Itpr3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103739696 (Itpr3)
   05163 Human cytomegalovirus infection
    103739696 (Itpr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103739696 (Itpr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103739696 (Itpr3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103739696 (Itpr3)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103739696 (Itpr3)
Ion channels [BR:ngi04040]
 Ligand-gated channels
  IP3 receptor
   103739696 (Itpr3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 103739696
NCBI-ProteinID: XP_017655358
LinkDB
Position
Un
AA seq 2763 aa
MGERGTPRVESPELQRGPRGTTVREGRAGWEGGGANRRGHVFFVTPGRAAPPPTPEVPPP
PRQYPPPGRPDRRDRRAPRRPRHLGGAPRRAKAMNEMSSFLHIGDIVSLYAEGSVNGFIS
TLGLVDDRCVVEPAAGGLDNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADV
VLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNA
MRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASSYELSDNPGC
KEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTCDEYKGKLQVFLRT
TLRQSATSATSSNALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDV
ADPKAAGLGAQSRVGRRNAGDKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYV
RLRHLCTNTWIQSTNVPIDVEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFAND
ASTMLASTVEKLNEGFISQNDRRFVIQLLEDLVFFVSDVTNNGQNVLDIMVSKPNRERQK
LMREQNILKQIFGILKAPFRDKGGEGPLVRLEELSDQKNAPYQHMFRLCYRVLRHSQDDY
RKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNRE
PRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQSHEYLSIEY
SEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLA
IDEISQQLGVDLLFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIP
TAITIKDYDSNLNASRDDKKNKFASTMEFVEDYLNNVVSEAVPFANEEKNKLTFEVVSLA
HNLIYFGFYSFSELLRLTRTLLGIIDCVQAPPAMLQAYEESGGKNVRRSIQGVGHMMSTM
VLSRKQSVFGAPSLPAGAGAPEPLDRSKFEDNEDIVVMETKLKILEILQFILNVRLDYRI
SYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEV
DDEGGRMFLRVLLHLTMHDYPPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENY
KVIKSELDRLRTMVEKSELWVDKKGSSKGEEGEGGTAKEKKERPSDEEGFLPSPGEKSSE
NYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKGDSKMLEILRY
THHFLQKFCTGNPGNQALLHKHLQLFLTPGLLEADTMQHIFFNNYQLCSEISEPVLQHFV
HLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLE
MMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVSVVTHEDCIT
EVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMALVCNKREKRLSDPTLEKY
VLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECSWLQQQHKGSVEACVR
TLAMVAKSRAILLPMDLDAHISALLSSGASSVTTAQRNAANYKTATRTFPRVIPTANQWD
YKNIIEKLQDIITALEERLKPLVQAELSVLVDVLHWPELLFLEGSEAYQRCESGGFLSKL
IRHTKGLMESEEKLCVKVLRMLQQMLLKKSKYGDRGNQLRKMLLQNYLQNRKSSSWGELP
DPTGSGQDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIRLLDGGNTE
IQKSFYNLMMSDKKSERFFKVLHDRMKQAQQETKSTVAVNMSDLSSPPHEDREPPDPTTK
GRVASFSMPSSSSRYSLGPSLHRGHEVGERVQNEMGTSVLVMRPILRFLQLLCENHNRDL
QNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYC
QGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRH
DSENAERILISLRPQELVDVIKKAYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQ
HLLKPVKRIQEEEAEGISSMLSLNNKQLSQMLKSSAPAQEEEEDPLAYYENHTSQIEIVR
QDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRL
RSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEGASTGVLGSPLISLLFWILIC
FSIAALFTKRYSVRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFI
RGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRS
ILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPGNHSRASPLGMPHGAATFVGTCSRD
EMGCVSGVSVPEFLEEDGELDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRKPSKDES
LFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKF
DNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAM
SLVSNEGEGEQNEIRILQEKLGSTMKLVSHLTAQLNELKEQMTEQRKRRQRLGFVDVQNC
MSR
NT seq 8292 nt   +upstreamnt  +downstreamnt
atgggggagcggggaactccaagggtggagagccccgaattgcagcggggtccccgggga
actaccgtacgcgagggccgggctgggtgggagggcggcggggcgaacagacgcgggcac
gtcttcttcgtgacccccggccgcgccgcgcctcctcccactcccgaggtacccccacct
ccccgccagtacccgcctcccgggcgcccggatcgtcgcgatcgccgggctccgaggcgt
cctcgtcacctcggaggggccccccggagggccaaagccatgaacgaaatgtccagtttt
cttcacatcggggacatagtgtccctgtacgccgagggctccgtcaatggcttcatcagc
actttggggctggtggatgaccgctgtgtggtagagcctgcagccgggggcttggacaat
ccccccaagaagttccgagattgcctcttcaaggtgtgccccatgaaccgctactcagca
cagaagcagtactggaaggctaagcagacgaagcaggacaaagagaagatcgctgacgtg
gtgttgctacagaagctgcagcatgcggcccagatggagcagaaacaaaatgacacggag
aacaagaaggtgcatggcgacgtggtgaagtatggcagcgtgatccagcttctgcacatg
aagagtaacaaatacttgacggtgaacaagcggcttccagccttgctggagaaaaatgcc
atgcgggtgacgctggatgccacaggcaacgagggctcctggcttttcatccagcccttc
tggaagctgcggagcaatggggacaatgtggtcgttggggacaaggtgattctgaatcct
gtcaatgcagggcagcctctgcatgctagcagttacgagctcagtgacaatcccggctgc
aaggaggtcaactctgtgaattgcaacaccagctggaagatcaacctgttcatgcaattc
cgggatcaccttgaggaggtgttgaaggggggagatgtggtgcggctcttccacgcagaa
caggagaagttcctgacttgtgatgagtacaagggcaaactgcaggtcttcctgcgcacc
acactgcgccagtcggccacctcagccaccagctccaacgcactctgggaggtggaggtg
gtccaccatgatccttgccgaggaggagctggccactggaatggtctataccgctttaag
cacctggccacaggcaactatctggctgctgaggaaaacccaagctacaaaggtgatgtt
gcagaccccaaggcagcaggattgggggcccagagtcgtgtaggccgcaggaacgcaggg
gacaagatcaagtaccgtctcgtggccgtgccccatggcaatgacattgcctctctcttt
gagctggaccccacaacactgcagaaaaccgactcctttgtgccccggaactcgtatgtg
cggctgcggcacctctgtaccaacacctggatccagagcactaatgtgcctattgacgta
gaagaggagcggcctatccggcttatgctgggcacctgccccaccaaggaagacaaggag
gcctttgccattgtgtcggtgcctgtgtctgagatccgagatctggactttgccaatgat
gcaagcactatgctggccagcactgtggagaagctcaatgagggtttcatcagccagaat
gaccgcaggtttgtcatccagctgctggaggacctggtgttttttgtcagtgatgttacc
aacaacgggcagaacgttctggacatcatggtctccaagcccaaccgggagcgacagaag
ctgatgcgggagcagaacatcctcaagcagatttttggcatcctgaaggctccattccgt
gacaaggggggcgagggcccgctggtgcggctggaggagctgtcggaccagaaaaatgcc
ccctaccagcacatgttccgcctgtgctaccgtgtgctacggcactcgcaggacgattac
cgtaagaaccaggagcacatcgctaagcagtttgggatgatgcaatctcagattggttac
gacatcctggctgaggacaccatcactgccctgcttcacaataaccgcaagctgctggag
aagcacattaccaagacagaggtggagaccttcgtcagcctcgtgcgcaagaaccgagag
cccaggttcctggactacctctctgacctgtgtgtatccaatcacattgccatccctgtc
acccaggagctcatttgcaagtgtgtgctggaccccaagaacagcgacattctcatccag
actgagctgcggccagtgaaggagatggcccagtctcacgagtacctcagcatcgaatac
tcagaagaggaagtgtggctcacgtggactgacagaaataacgaacatcatgagaagagc
gtgaggcagctggcccaggaggcgcgggcaggcaatgcccatgatgagaatgtgctcagc
tactacagataccagctgaagctatttgcccgcatgtgtctggaccgccagtacctggcc
attgacgagatctcccagcagctgggtgtggacctgcttttcctgtgcatggctgatgag
atgctgcccttcgacctccgggcctccttctgccacctgatgctgcatgtgcacgttgac
cgcgacccccaggagctggtgacacccgtcaagttcgcccgtctctggacagagatcccc
accgccatcaccatcaaggactatgattccaacctcaacgcctcccgagatgacaagaag
aataagtttgcgagcaccatggagttcgtggaggattacctcaacaacgtggtcagcgag
gcggtgccctttgccaatgaggagaagaacaagctcacctttgaggtggtcagcctggcg
cacaatctcatctacttcggcttctacagcttcagcgagctgctgcggctcactcgcacg
ctgctgggcatcatcgactgcgtgcaggcgcccccggccatgctgcaggcttatgaggag
tctggtggcaagaacgtgcggcggtccatccagggtgtgggccacatgatgtccaccatg
gtgctgagccgcaagcagtctgtctttggtgcgcccagcctgcctgctggcgcgggtgcc
cctgagccgctggacaggagcaagttcgaggataatgaagacatagtggtgatggagacc
aaactgaagatcctggagatcctgcagttcatcctcaacgtgcgcctggactatcgcatc
tcctacctgctgtcggtcttcaagaaggagtttgtggaggtgttccccatgcaggacagt
ggggcagacggcacagctcctgccttcgactctaccactgccaatatgaatctggaccgc
attggagagcaagcagaggccatgtttggagtggggaagaccagcagcatgctggaggtg
gatgacgagggcggccgcatgttcctgcgtgtgctgctgcacctgaccatgcacgactac
ccgccactcgtctctggagccctgcagcttctcttcaagcactttagccagcgccaagag
gccatgcacaccttcaagcaggtccagctgctgatctcggcccaggacgtagagaactac
aaggtgatcaagtcggaactagaccggctgaggacgatggtggagaagtcggagctctgg
gtggacaagaagggcagcagcaagggcgaggagggggaggggggcactgccaaggagaag
aaggagcggccctcggatgaggagggatttctgccgtcacctggggagaagagcagtgag
aactatcagattgtcaagggcatcctggagcggttgaacaagatgtgtggggtcggagag
cagatgaggaagaagcaacagaggcttttgaagaacatggatgcccataaagtcatgctg
gacctgctccagatcccctatgacaagggtgacagcaagatgctggagattctccgctac
acacaccatttcctgcagaagttttgcaccgggaaccctggcaaccaggccctgctgcac
aagcacctgcagctcttcctcacgcctgggctcctggaggcagacaccatgcagcacatc
ttcttcaacaactaccagctgtgctccgagatcagcgagccagtgctgcagcacttcgtg
cacctgctggccacccacgggcgccacgtgcagtacctggatttcctgcacactgtcatc
aaggccgagggcaagtatgtgaagaagtgccaggacatgatcatgactgagctgaccaat
gcaggtgatgacgtggtagtgttctacaatgacaaagcctcgctagcccacctcctagaa
atgatgaaggcggcccgagatggtgtggaggatcacagccccctcatgtaccacatctcc
ctggtggacttgttggccgcctgtgcagagggcaagaatgtgtacacagagatcaagtgt
acctccctgctgccgctggaggatgtggtgtcggtggtgacgcacgaggactgtatcacg
gaggtgaaaatggcctatgtgaactttgtgaaccactgctacgtggacacagaggtggag
atgaaagagatctacaccagcaaccacatctggacgctctttgagaacttcaccttggac
atggctcttgtctgtaacaagcgggagaagcgcctgtcggaccccaccctggagaagtat
gtgctcaccgtggtgctggacaccatcagcgccttcttcagctccccgttctcagagaac
agcacctcactgcagacgcaccagacaattgtagtccagctgttgcagtccaccacaagg
ctgcttgagtgttcctggcttcagcagcaacacaaggggtctgtggaggcctgtgtccgc
acccttgccatggtggccaagagccgggccatcttgctgcccatggacctggatgcccac
atcagcgccctgctcagtagtggggccagcagtgtaaccactgcccagcgcaatgctgcc
aactacaagacagccacgaggaccttcccccgagtcatccccaccgccaatcagtgggac
tacaagaacatcattgagaagctgcaggacatcatcacggccctggaggagcggctgaag
cccctggtgcaggctgagctgtcagtgctggtggatgtgctgcactggcctgagctgctc
ttcctggagggcagtgaggcttaccagcgctgtgagagtgggggcttcctgtccaagctg
atccggcacaccaagggcctcatggagtcggaggagaaactgtgcgtgaaggtgctgcgg
atgctgcagcagatgctgctgaagaagagcaagtacggggaccggggcaaccagctgagg
aagatgctgctgcaaaactacctgcagaaccgcaagtccagctcctggggagagcttcca
gaccccacaggctccggccaggaccaggactggtcagccattgcagccacccagtgccgg
ctggacaaggagggggccaccaagctggtatgcgacctcatcactagcacaaagaacgag
aagatcttccaggagagcattggcttggccatccgtctgctggacgggggcaacaccgag
atccagaaatccttctacaacctgatgatgagcgacaagaaatctgagcgcttcttcaag
gtgctgcacgaccgcatgaagcaagctcagcaggagaccaagtccactgtggccgttaac
atgagtgacctgagcagtccaccacatgaggaccgtgagccaccagaccccacaaccaaa
ggccgtgtggcctccttctccatgcccagctcctcctcccgctattcgctgggccccagc
ctgcaccgggggcatgaggtgggtgagcgcgtgcagaacgagatgggcacctccgtgcta
gtgatgcggcccatcctgcgattcctgcagctgctgtgtgagaatcacaaccgtgaccta
cagaacttcctgcgctgtcagaacaacaagaccaactacaacctggtgtgtgagacgctg
cagttcctggacatcatgtgtggcagcaccacggggggcctggggctgctggggttgtac
atcaacgaggacaacgtgggcctcgtcatccagactctggagactctcaccgagtactgc
caaggcccgtgtcatgagaaccagacctgcattgtgactcacgagtccaatggcattgac
atcatcactgcactgattctcaacgacatcagcccactgtgcaagtaccgcatggatttg
gtgctgcagctcaaggacaacgcctccaagctgctcctggctctgatggagagtcgacat
gacagtgagaacgcagagcgcatcctcatcagcctgcggcctcaggagctggtggacgtc
atcaagaaagcctacctgcaggaagaggagcgggagaactcggaggtgagcccacgtgaa
gtgggccacaacatctacatcctggcgctgcagctttccagacacaacaaacagctgcaa
cacctgctgaagccggtcaaacgcatccaggaggaggaggccgagggcatttcttccatg
ctcagcctcaacaacaagcagctgtcccagatgctcaagtcttctgcgccagctcaggag
gaggaggaagacccgctggcctactatgagaaccacacctcacagatcgagatcgtgcgg
caagaccgaagcatggagcagatcgtgttcccggtgcccggcatctgccagttcctgacg
gaggagacaaagcaccggctctttaccaccactgagcaggatgaacagggcagcaaagtg
agcgacttttttgaccagtcctccttcctgcacaacgagatggagtggcagcgccggctc
cgcagcatgccgcttatctactggttctcccgccgcatgacgctgtggggtagcatctcc
ttcaacctggctgtgttcatcaacatcatcatcgccttcttctacccctacgtagagggc
gcgtccacaggcgtgctgggctccccgctcatctcactgctcttctggatcctcatctgc
ttctccattgcggcgctgttcaccaagcgctacagtgtccgccccctcatcgtggctctc
atcctgcgctccatctactacctgggcatcgggcccacgctcaacatcctgggtgccctc
aatctgaccaacaagatcgtgtttgtggtgagcttcgtgggtaaccgtggcaccttcatc
cgaggctacaaggccatggtcatggacatggagtttctgtaccatgtgggctacatcctg
acaagtgtcctgggcctcttcgcccatgagctgttctacagcattctactctttgacctc
atctatcgtgaggagacactgttcaatgtcatcaagagtgtgacccgcaatggccgctcc
atcctgctgactgccctgctggccctcatccttgtctacctcttctctatcgtgggcttc
ctcttcctcaaggatgacttcatcctcgaggtggaccggctgcctgggaaccactccaga
gccagccccctggggatgccacatggagctgccacgtttgtgggcacgtgcagtagggat
gagatgggctgtgtttcgggggtctcagtaccagagtttctggaagaggatggggagctc
gatagcacagagcgggcctgcgacactttgctcatgtgcatcgtcactgtcatgaaccac
gggttgcgcaacggcggtggcgtgggcgacatcctccgcaagccctccaaagatgagtcc
ctcttccctgcccgggtggtatatgacctcctgttcttcttcatcgtcatcatcatcgtg
ctgaacctcatcttcggggtgatcatcgacaccttcgccgatctgcgaagtgagaagcag
aagaaggaagagatcctcaagaccacgtgcttcatctgcggtctggaaagggacaagttc
gacaacaagacggtgtccttcgaggagcacatcaagctggagcacaacatgtggaactac
ctgtacttcattgtgctggtccgtgtcaagaacaagaccgactacaccggccctgagagc
tacgtggcccagatgatcaagaacaagaacctggactggttcccaaggatgcgggctatg
tccctagtgagcaatgagggtgagggtgagcagaatgagattcgcatcctgcaggagaag
ctgggctccaccatgaagctggtatcacaccttaccgcccagctcaacgagctcaaggag
cagatgacagagcagcggaaacgcaggcaacgcctgggctttgtggatgtgcagaactgc
atgagccgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751203
Entry
103751203         CDS       T03372                                 

Gene name
Itpr1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04114  Oocyte meiosis
ngi04140  Autophagy - animal
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05163  Human cytomegalovirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103751203 (Itpr1)
   04020 Calcium signaling pathway
    103751203 (Itpr1)
   04070 Phosphatidylinositol signaling system
    103751203 (Itpr1)
   04022 cGMP-PKG signaling pathway
    103751203 (Itpr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103751203 (Itpr1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103751203 (Itpr1)
   04210 Apoptosis
    103751203 (Itpr1)
   04218 Cellular senescence
    103751203 (Itpr1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103751203 (Itpr1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103751203 (Itpr1)
   04621 NOD-like receptor signaling pathway
    103751203 (Itpr1)
   04625 C-type lectin receptor signaling pathway
    103751203 (Itpr1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103751203 (Itpr1)
   04929 GnRH secretion
    103751203 (Itpr1)
   04912 GnRH signaling pathway
    103751203 (Itpr1)
   04915 Estrogen signaling pathway
    103751203 (Itpr1)
   04921 Oxytocin signaling pathway
    103751203 (Itpr1)
   04935 Growth hormone synthesis, secretion and action
    103751203 (Itpr1)
   04918 Thyroid hormone synthesis
    103751203 (Itpr1)
   04928 Parathyroid hormone synthesis, secretion and action
    103751203 (Itpr1)
   04924 Renin secretion
    103751203 (Itpr1)
   04925 Aldosterone synthesis and secretion
    103751203 (Itpr1)
   04927 Cortisol synthesis and secretion
    103751203 (Itpr1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103751203 (Itpr1)
  09154 Digestive system
   04970 Salivary secretion
    103751203 (Itpr1)
   04971 Gastric acid secretion
    103751203 (Itpr1)
   04972 Pancreatic secretion
    103751203 (Itpr1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103751203 (Itpr1)
   04725 Cholinergic synapse
    103751203 (Itpr1)
   04728 Dopaminergic synapse
    103751203 (Itpr1)
   04726 Serotonergic synapse
    103751203 (Itpr1)
   04720 Long-term potentiation
    103751203 (Itpr1)
   04730 Long-term depression
    103751203 (Itpr1)
   04723 Retrograde endocannabinoid signaling
    103751203 (Itpr1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103751203 (Itpr1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103751203 (Itpr1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103751203 (Itpr1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103751203 (Itpr1)
   05012 Parkinson disease
    103751203 (Itpr1)
   05016 Huntington disease
    103751203 (Itpr1)
   05017 Spinocerebellar ataxia
    103751203 (Itpr1)
   05020 Prion disease
    103751203 (Itpr1)
   05022 Pathways of neurodegeneration - multiple diseases
    103751203 (Itpr1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103751203 (Itpr1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103751203 (Itpr1)
   05163 Human cytomegalovirus infection
    103751203 (Itpr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103751203 (Itpr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103751203 (Itpr1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103751203 (Itpr1)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103751203 (Itpr1)
Ion channels [BR:ngi04040]
 Ligand-gated channels
  IP3 receptor
   103751203 (Itpr1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 103751203
NCBI-ProteinID: XP_008852790
LinkDB
Position
Un
AA seq 2757 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMAKGEENKGNNDEEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAP
EGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSET
SSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHD
YPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSEL
WVYKGQGPDETMDGASGENEHKKTEEGNKPQKHESTSSYNYRVVKEILIRLSKLCVQESA
SVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQ
ALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFL
QTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLM
YHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVD
TEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSS
PFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPV
DLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALED
RLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCI
KVLQTLREMMTKDRGYGEKQISIDELDNAELPQAPEAENSTEQELEPSPPLRQLEDHKRG
EALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPAGGGGSSGSSSMSRGEMSLA
EVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKS
EKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEIDRDAPSRKKAKEPTTQITEEVR
DQLLEASAATRKAFTTFRREADPDDHYQSGEGTQAAADKTKDDLEMSAVITIMQPILRFL
QLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALI
NQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNAS
KLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVG
HNIYILAHQLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVP
SICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNM
SFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHLSGLLWTAMLISLAIVIALPKPHGI
RALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFL
YHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVY
LFSIVGYLFFKDDFILEVDRLPNETAVPETSESLASDFLYSDVCRVETGENCTSPAPKEE
LLPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLF
FFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIK
EEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIRERNLDWFPRMRAMSLVSSDSEGEQN
ELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8274 nt   +upstreamnt  +downstreamnt
atgtcggacaaaatgtctagtttcctgcacattggagacatttgttctctgtatgcggag
ggatcgacaaatggatttatcagcaccttgggcctggttgatgatcgttgcgttgtacag
ccagaagctggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcctatgaaccgctattctgcccagaaacagttctggaaagctgccaaacctggggcc
aacagcacaacagatgcggtgctgctcaacaaattgcaccatgctgcagacttggaaaag
aaacagaatgagacagaaaacaggaaactgctggggaccgtgatccagtatggcaatgtg
attcagctcctgcatttgaaaagcaataaatacctaactgtgaacaagaggcttccggct
ctgctagagaagaacgccatgagagtgacattggatgaggcgggaaatgaagggtcctgg
ttttacatccagccattctataagcttcgatccatcggagacagtgtggtcataggcgac
aaggtggttctgaaccctgtcaatgctggccagcccctacatgccagcagccatcagctg
gtggataaccctggctgcaatgaggtcaactctgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagcgataacaaagatgacattttaaaaggaggcgatgtggtg
aggctcttccatgcagaacaagagaagtttctcacatgtgatgagcacaggaagaaacag
catgtgtttctgaggacaactggcagacagtcagccacatcagccaccagttcaaaagcg
ctttgggaggttgaggtagtccagcatgacccatgtcggggtggagctggttactggaac
agcctcttccggttcaagcacctggccacagggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgaccaagatgcatct
cggagtagattgcgaaatgcccaagaaaaaatggtgtactctctggtctctgtacccgaa
ggcaatgatatctcctccatttttgagctagaccccacaactctacgtggaggggacagt
cttgtcccaaggaactcctatgtccgactcagacacctttgtacaaatacgtgggtccac
agcacaaacattcccattgacaaggaggaagaaaaacctgtgatgctgaaaattggtacc
tctcccgtgaaggaggataaggaagcatttgccatagttcccgtttctcctgctgaagtg
cgggacctggactttgccaatgatgccagcaaggtgttgggctccattgcagggaagctg
gaaaagggcaccatcacccagaatgaaagaaggtctgtcaccaagctgctggaagacttg
gtttactttgtcacgggtggcactaactctggccaagatgtgcttgaagtagtcttctcg
aagcccaacagagagcggcagaagctgatgagggaacagaatattctcaagcagatcttc
aagctgttgcaggcccccttcacagactgtggggatggcccgatgcttcggctggaggag
ctgggggatcagcgccatgctcctttccgacacatctgtcggctctgctacagagttctg
agacactcacagcaagactacaggaagaatcaggagtacatagccaagcagtttggcttc
atgcagaaacaaattggctatgatgtgctggctgaagataccatcactgccctgctccat
aacaaccggaaactcctggaaaagcacatcaccgctgcagagatcgacacatttgtcagc
ctggtgcgaaagaacagggagcccaggttcttagattacctctctgacctctgcgtgtcg
atgaacaaatcgattcccgtgacccaggaactcatctgtaaggctgtgctgaatcccacc
aatgctgacatcctgattgagaccaagttggttctttctcgattcgagtttgaaggtgtt
tccactggagagaatgctctggaagctggagaggatgaggaagaggtgtggctcttctgg
agggacagcaacaaagagatccgtagtaagagtgtcagggaattggcccaagatgccaaa
gaagggcaaaaggaagaccgggatgttctcagctactacaggtatcagctgaacctcttt
gcgaggatgtgtctggaccgccagtacctggccatcaatgaaatatctggccagctagac
gttgatctcattctccgctgcatgtctgatgagaacctgccctatgacctgagggcgtcc
ttctgccgcctcatgcttcacatgcatgtggaccgagatccccaggagcaggtcacccct
gtgaagtatgcccgcctctggtcagagattccctctgagatcgccattgacgactatgac
agtagtggaacttcaaaagatgagattaaggagagatttgctcagaccatggaatttgtg
gaggaatatttaagggatgtggtttgtcagaggtttcccttctctgataaagaaaaaaat
aagctcacgtttgaggttgtaaacttagccaggaatctcatatactttggtttctacaac
ttctctgatcttctgcgattaaccaagatcctcctggccatattagactgtgtgcatgtg
accaccatcttccccattagcaagatggcaaagggagaagagaataaaggtaacaatgat
gaggagaaactgaagagcagtaatgtgatgaggtctatccatggagttggggaactcatg
acccaggtggtgctccggggaggaggctttttgcctatgacccccatggctgctgcccct
gaaggcaacgtgaagcaggcagagccagagaaggaggacatcatggtcatggacaccaag
ctgaagatcattgaaatactccagtttattttgaatgtgaggttggattataggatctcc
tgcctcctgtgtatatttaagcgggagtttgatgaaagcaattcccagacatcggaaaca
tcttccggaaatagcagccaagaagggccgagtaatgtaccaggtgctcttgactttgaa
cacattgaagagcaagcagaaggcatctttggaggaagtgaggagaacacaccactggac
ttggatgatcatggtggtagaaccttccttagggtcctgctccacttgacgatgcatgac
tacccacctctggtgtcaggggccctgcagctcctgtttcgacacttcagtcagaggcag
gaggtccttcaggccttcaaacaggtccaactgctggttaccagtcaagatgtagacaac
tacaaacagatcaaacaagacttggaccagctgcggtccattgtggaaaagtctgagctc
tgggtgtacaagggtcagggacctgatgaaaccatggatggtgcctctggtgaaaatgaa
cataaaaaaaccgaggaagggaataagccacaaaagcatgaaagcaccagcagctacaac
tacagagtggtgaaagagattttgattcgacttagcaagctctgtgtgcaagagagcgcc
tcggtgaggaagagcaggaagcagcagcagaggctgctgaggaacatgggtgcacacgct
gtggtgctggagctgctgcagatcccctacgagaaggccgaagataccaagatgcaggag
ataatgaggctagctcatgaatttttgcagaatttctgtgcaggcaaccagcagaatcaa
gctttgctgcataaacacataaacctgtttctcaacccagggatcctggaggcagtgact
atgcagcacatcttcatgaacaacttccagctgtgcagtgagatcaatgagagagtggtc
cagcacttcgttcactgcatagagacccatgggcggaacgtccagtatataaagttcctg
cagacaattgtcaaggcagaagggaaattcataaaaaagtgccaagacatggtcatggct
gagctggtcaattccggagaagacgtcctcgtgttctacaacgacagagcctctttccag
actcttatccaaatgatgcggtcagagcgggaccgcatggatgagaatagccctctcatg
tatcatatccatctggtggagctcttggctgtgtgcactgagggcaagaatgtctacaca
gagatcaagtgcaactccctgctcccactcgatgatattgtccgagtggtcacccatgaa
gattgcatccctgaggttaaaattgcttacatcaacttcctgaatcactgctatgtggat
acagaggtggagatgaaggagatctacaccagcaatcacatgtggaagttgtttgagaat
ttcctcgtggacatctgcagggcttgtaacaacacgagtgacaggaagcatgcagactcc
attttggagaagtatgtcactgaaatcgtgatgagcatcgttactaccttcttcagctct
cccttctcagaccagagcaccactctgcagactcgccagcctgtctttgtgcaactctta
caaggcgtgttcagggtttaccactgcaactggttaatgccgagccaaaaagcctctgtg
gagagctgcatccgggtgctctctgatgtagccaagagccgggccatagccattcctgta
gacctggacagccaagtgaacaacctcttcctgaagtcccacaacattgtgcagaaaaca
gccatgaactggcggttgtcagcccgcaacgctgctcgtagagactctgttctggcagct
tccagagactaccggaatatcattgagagattgcaggacatcgtctctgccctggaggac
cggctcaggccactggtccaggctgagttatctgtgcttgtggatgtcctacacagacct
gagctgcttttccctgagaacacagatgcccggaggaaatgtgaaagtggcggtttcatt
tgcaagttaataaagcacaccaaacagctgctagaggagaatgaagagaaattgtgcatt
aaagtcttgcagactctcagggagatgatgactaaagatagaggctatggcgaaaagcaa
atttccattgatgaattggataatgctgagctgccacaggcaccggaagctgagaactcc
acagagcaggagcttgaaccaagtccacccctgaggcaactggaagaccataaaaggggt
gaggcgctcaggcaaattttggtcaaccgttactatggaaacatcagaccttcgggaaga
agagagagccttaccagctttggcaatggcccactgtcaccaggaggacccagcaagcct
gcgggaggagggggcagttctgggtccagctccatgagcaggggggagatgagcctggcc
gaggttcaatgtcaccttgacaaagagggagcctccaatctggtcatcgacctcataatg
aacgcgtccagtgaccgagtgttccatgaaagcattctcctggccatcgctcttctagaa
ggaggcaacaccaccatccagcactcctttttctgccggttgaccgaagacaagaagtca
gagaaattcttcaaggtcttttatgatcgaatgaaggtggcccaacaggaaatcaaggca
accgtgaccgtaaataccagtgacttgggaaacaaaaagaaagatgatgagatagacagg
gatgccccatcccggaagaaagccaaagagcccacaacacagataacagaagaggtccgg
gatcagttgctggaggcatctgctgctaccaggaaagctttcaccaccttccggagggag
gctgaccctgacgaccattaccagtctggagagggcacccaggccgcagctgacaagacc
aaggatgacctggaaatgagcgcagtcatcactattatgcagcccatcctacgcttcctg
cagctcctgtgtgaaaaccacaaccgagacctgcagaatttccttcgttgccaaaataat
aagaccaactataatttggtgtgtgagacgctacagtttctggactgtatttgtggcagc
acaactggaggccttggtcttctcggactgtatataaatgaaaagaatgtagcacttatc
aaccaaaccctggagagtctgaccgagtactgtcaaggtccttgccacgagaaccagaac
tgcattgccacccacgagtccaatggcatcgatatcatcacggccctcatcctcaatgac
atcaaccctctgggaaagaagcggatggaccttgtgttagaactgaagaacaatgcatca
aagcttctcctggccatcatggaaagcaggcacgacagtgaaaatgcagagaggattctg
tacaacatgaggcccaaggagctggtggaggtgatcaagaaagcctacatgcagggtgaa
gtggaatttgaggatggggagaatggtgaggatggagcagcctcccccaggaatgtgggt
cacaacatctacatcctcgctcaccagttggctcggcataacaaagaacttcagaccatg
ctgaaacccggaggccaggtggacggagatgaagctctggaattctatgccaagcatacg
gcacagattgagattgtcagattagacagaacaatggaacagattgtcttcccagtaccc
agcatctgtgaattcctgaccaaggaatcaaaactgcgaatatactataccacggagagg
gatgagcaaggcagcaagatcaatgacttcttcttgcgctccgaggacctcttcaatgaa
atgaactggcagaagaaacttcgagcccaacctgtcttatactggtgtgcccgcaacatg
tctttctggagcagtatttcatttaacctggctgtcctgatgaacctgcttgtagccttt
ttctacccatttaaaggagtgcgaggaggaacactagagccacacttgtcaggcctcctg
tggacagccatgctcatttctctggccatcgtcattgctctgcccaagccccatggcatc
cgggccttaattgcatccacaattctacgactgatattctcagttgggttacaacccaca
ttgtttctgctgggagctttcaatgtctgcaataaaatcatctttctgatgagttttgtg
ggcaactgtggaacattcaccagaggctaccgagccatggttctggacgttgaattcctc
tatcatctgctgtacctgctcatctgtgccatgggcctctttgtccatgagttcttctat
agtctgctgcttttcgacctggtatacagagaagagactttgcttaatgtcattaaaagt
gtcacccgcaatggacggtccatcatcttgacagcagtcctggctctgatcttggtttac
ctgttctcaatagtgggctatctcttcttcaaggatgattttatcttggaagtagatagg
ttgcccaatgagactgctgttccagaaaccagcgagagtttggcaagcgatttcctgtac
tctgatgtgtgcagggtggagacgggggagaactgcacctctcctgcacccaaagaagag
ctgctccctgcagaagaaacggaacaggataaggaacacacgtgtgagacgctgctcatg
tgcatagtcactgtactgagtcacgggctgcgaagcgggggcggagtgggagatgtgctc
aggaagccatccaaagaggagcccctgtttgctgcaagagtgatctacgaccttctgttc
ttcttcatggtcatcatcattgtcctgaacctgatttttggagtcatcatcgacaccttt
gctgacctgaggagtgagaaacagaagaaggaggagatcttaaagaccacatgcttcatc
tgtggcttggaaagagacaagtttgacaacaagactgtcacctttgaagagcacatcaag
gaagaacataacatgtggcactatctgtgttttattgtgctggtgaaagtgaaggactcc
acagaatacactggaccagagagttacgtggcagaaatgatcagggaaagaaaccttgat
tggttccccaggatgagagccatgtccctggtcagcagtgattccgaaggagaacaaaac
gagctaaggaacctgcaggagaagctggaatccactatgaagcttgtcaccaatctttct
ggccagctgtcagaattaaaggaccagatgacagaacagaggaagcagaagcaaagaatc
ggtcttctaggacaccctcctcacatgaatgtcaacccacagcaaccagcctag

DBGET integrated database retrieval system