KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739713
Entry
103739713         CDS       T03372                                 

Gene name
Rxrb
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03320  PPAR signaling pathway
ngi04659  Th17 cell differentiation
ngi04919  Thyroid hormone signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05216  Thyroid cancer
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103739713 (Rxrb)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103739713 (Rxrb)
   03320 PPAR signaling pathway
    103739713 (Rxrb)
   04919 Thyroid hormone signaling pathway
    103739713 (Rxrb)
   04928 Parathyroid hormone synthesis, secretion and action
    103739713 (Rxrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739713 (Rxrb)
   05202 Transcriptional misregulation in cancer
    103739713 (Rxrb)
  09162 Cancer: specific types
   05226 Gastric cancer
    103739713 (Rxrb)
   05216 Thyroid cancer
    103739713 (Rxrb)
   05222 Small cell lung cancer
    103739713 (Rxrb)
   05223 Non-small cell lung cancer
    103739713 (Rxrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103739713 (Rxrb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ngi03310]
    103739713 (Rxrb)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103739713 (Rxrb)
Nuclear receptors [BR:ngi03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103739713 (Rxrb)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 103739713
NCBI-ProteinID: XP_008838406
LinkDB
Position
Un
AA seq 530 aa
MSWAARPPFLPPPHAAGQCGPVGVRREMHCGVASRWRRRRPWLDPAAAAAAAAVAAGEQP
SPEPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLSQGIPPPSPPGPPLLPSAPPPPMPPP
PLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGAR
GLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDC
TVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEA
ELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDD
QVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTE
LVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPGEVEVLREKVYASLETYCKQKYPEQQ
GRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtcctgggccgcccgcccgcccttcctcccgccgccgcatgccgcggggcagtgtggg
ccggtgggggtgaggagagagatgcattgtggggtcgcgtcccggtggaggcggcggcgg
ccctggctggatcccgcggcggcggcggcggcggcggcggtagcggccggagagcagccg
agcccggagcccgagccggagccgggggaggctggccgggacgggatgggcgacagcggg
cgggactccagaagcccagacagctcctccccaaatcctctttcccaggggatccctccc
ccttctcctcctggcccacctcttctcccttcagcacctccacctccaatgccaccccct
ccactgggctcccccttcccagttatcagttcttccatggggtctcctggtctaccccct
ccggctcccccaggattctccgggcctgtcagcagtcctcagattaactcaacagtgtct
ctccctgggggtgggtctggcccccctgaagatgtgaagccaccggtcttaggggcccgg
ggcctgcactgtccaccccctccaggtggcccaggggccggcaaacggctatgtgcaatc
tgcggggaccgaagctcaggcaagcactatggggtttacagctgtgagggctgcaagggc
ttcttcaagcgcaccattcggaaggacctgacctactcttgtcgggacaataaagattgt
acggtggacaagcgtcagcggaaccgctgtcagtactgtcgctatcaaaagtgcctggcc
accggcatgaagagggaggcggtacaggaggagcgtcagcgggggaaggacaaggacggg
gatggggagggggctgggggagcccccgaggagatgcctgtggacaggatcctggaggca
gagcttgctgtggagcagaagagtgaccaaggcgttgagggtcctgggggaaccgggggt
agcggcagcagcccaaatgaccccgtgactaacatctgccaggcagctgacaaacagcta
ttcacgcttgttgagtgggcgaagaggatcccccatttttcttccttacctctggatgac
caggtcatactgctacgggcaggctggaatgagctcctcattgcctccttctcccatcgg
tccattgatgtccgagatggcatcctcctggccacaggtcttcacgtgcacagaaactca
gcccattccgcaggcgtgggagccatctttgatcggtccctctccagggtgctgacagag
ctagtgtccaaaatgcgagacatgaggatggacaagacagagcttggctgcctgcgggca
atcattctgtttaatccagatgccaagggcctctccaaccctggggaggtggaggtcctg
cgggagaaggtgtacgcatcactggagacttactgcaagcagaagtaccctgagcagcag
ggccggtttgccaagctgctgctacgtcttcctgccctccggtccattggccttaagtgt
ctagagcatctgtttttcttcaagctcattggcgacacccccattgacaccttcctcatg
gagatgctcgaggctccccaccagctggcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742823
Entry
103742823         CDS       T03372                                 

Gene name
Rxra
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03320  PPAR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04659  Th17 cell differentiation
ngi04919  Thyroid hormone signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04932  Non-alcoholic fatty liver disease
ngi04976  Bile secretion
ngi05160  Hepatitis C
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05216  Thyroid cancer
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103742823 (Rxra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103742823 (Rxra)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103742823 (Rxra)
   03320 PPAR signaling pathway
    103742823 (Rxra)
   04919 Thyroid hormone signaling pathway
    103742823 (Rxra)
   04928 Parathyroid hormone synthesis, secretion and action
    103742823 (Rxra)
  09154 Digestive system
   04976 Bile secretion
    103742823 (Rxra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742823 (Rxra)
   05202 Transcriptional misregulation in cancer
    103742823 (Rxra)
  09162 Cancer: specific types
   05226 Gastric cancer
    103742823 (Rxra)
   05216 Thyroid cancer
    103742823 (Rxra)
   05222 Small cell lung cancer
    103742823 (Rxra)
   05223 Non-small cell lung cancer
    103742823 (Rxra)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103742823 (Rxra)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103742823 (Rxra)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103742823 (Rxra)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ngi03310]
    103742823 (Rxra)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103742823 (Rxra)
Nuclear receptors [BR:ngi03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103742823 (Rxra)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 103742823
NCBI-ProteinID: XP_008842147
LinkDB
Position
Un
AA seq 439 aa
MAAPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMHMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQAT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggctgccccatcgctgcacccctccctgggaccaggcattggctctccactgggctcc
cctggacagctacactcgcccatcagcaccctgagctcccccatcaatggcatgggccca
cccttctctgtcatcagctcccccatgggcccccactccatgtcggtacccaccacaccc
accctgggcttcggaaccggcagcccccagctcaactcacccatgaatcctgtcagcagc
agcgaggatattaagcctcccctgggcctcaatggagtcctcaaggttcctgcccacccc
tcaggaaacatggcatccttcaccaagcacatctgtgctatctgtggtgaccgctcttca
ggcaaacactacggggtatacagctgtgagggctgcaaaggcttcttcaagaggacggtg
cgcaaggacctgacctacacctgccgggacaacaaggactgcctgatcgacaagcggcag
cggaaccggtgccagtactgccgttaccagaagtgcctggccatgggcatgaaacgggaa
gctgtacaggaggagcggcagcggggcaaagaccggaatgagaatgaggtggagtctaca
agcagcgccaatgaggacatgcccgtggagaagattctagaagccgagctggccgtcgag
cccaagactgagacttatgtggaggcgaacatgggactgaaccctagctcaccaaacgac
cctgtcactaacatctgccaggcggcggacaaacagcttttcacgcttgtggagtgggct
aagaggatcccgcacttctccgagctacccctggatgaccaggtcatcttgctacgggca
ggttggaacgagctgctcatcgcctccttctcccatcgctccatagctgtgaaggatggg
atcctccttgccaccggcctgcatgtacaccggaacagtgctcacagtgcgggtgtgggc
gccatctttgacagggtgctaacagagctggtgtccaagatgcgcgacatgcacatggac
aagacggagctgggctgcctgcgtgccattgtcctcttcaaccctgactccaaggggctc
tcaaacccggccgaggtggaggcgctgagggagaaggtgtatgcatctctggaggcctac
tgcaaacacaagtacccagagcagccgggcaggtttgccaagctgctgctccgcctgcct
gcactgcgctccatcgggctcaagtgcctggagcacctgttcttcttcaagctcatcggg
gacacgcctatcgacacctttctcatggagatgctagaggcccctcaccaggccacctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746119
Entry
103746119         CDS       T03372                                 

Gene name
Rxrg
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03320  PPAR signaling pathway
ngi04659  Th17 cell differentiation
ngi04919  Thyroid hormone signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05216  Thyroid cancer
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103746119 (Rxrg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103746119 (Rxrg)
   03320 PPAR signaling pathway
    103746119 (Rxrg)
   04919 Thyroid hormone signaling pathway
    103746119 (Rxrg)
   04928 Parathyroid hormone synthesis, secretion and action
    103746119 (Rxrg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746119 (Rxrg)
   05202 Transcriptional misregulation in cancer
    103746119 (Rxrg)
  09162 Cancer: specific types
   05226 Gastric cancer
    103746119 (Rxrg)
   05216 Thyroid cancer
    103746119 (Rxrg)
   05222 Small cell lung cancer
    103746119 (Rxrg)
   05223 Non-small cell lung cancer
    103746119 (Rxrg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103746119 (Rxrg)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ngi03310]
    103746119 (Rxrg)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103746119 (Rxrg)
Nuclear receptors [BR:ngi03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103746119 (Rxrg)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 103746119
NCBI-ProteinID: XP_008846446
LinkDB
Position
Un
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSAVLSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGSLAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
LGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASGGHEDMPVERIL
EAELAVEPKTESYGDMNMESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattactcccacttcatgaagtttcccacaggctttggcggctcccctggc
cacactggctccacatccatgagtccgtcggcagtcttgtccacagggaagccaatggac
agtcaccccagctacacagacaccccagtgagtgccccacgaacactgagtgctgtgggg
acacccctcaatgctctgggctctccatatcgagtcatcacttctgccatgggtccaccc
tcaggatcactggcagcccctccaggaatcaatttggtggccccacctagctctcagcta
aatgtggtcaacagtgtcagcagttccgaggacatcaagcccttaccaggtctgcccggg
cttggaaacatgaactacccatccaccagccctgggtctctggtgaaacacatttgtgcc
atctgtggggacagatcctcaggaaagcactacggagtgtacagctgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagatctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccaatactgtcgctaccagaagtgcctg
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagaggagccgggagagagct
gagagtgaggcagaatgtgccagtggtggccatgaagacatgccggtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctacggtgacatgaacatggagagc
tcgacaaatgaccctgttaccaacatatgccatgctgctgataagcagcttttcacactt
gttgagtgggccaagcgcatcccccatttctcagacctcaccttggaggaccaggtcatt
ctgctccgggccgggtggaatgaattgttgattgcctccttctcccaccgctcggtttcc
gtccaggacggcatcctgctggccacaggcctccatgtccaccggagcagtgctcacagt
gctggtgttggttccatctttgacagagttctcactgagctggtttccaagatgaaagac
atgcagatggataagtcagagctggggtgcctgcgagccattgtgctgtttaacccagat
gccaagggtctgtccaatccctcggaggtggagacactgcgtgagaaagtttatgccact
cttgaggcctataccaagcaaaagtatccagaacaaccaggcaggtttgccaagctgctg
ctacgcctcccagctctgcgctccatcggcctgaaatgcctggagcacctcttcttcttc
aagcttattggggatacccccattgacactttcctcatggagatgttggagaccccactg
cagatcacctga

DBGET integrated database retrieval system