KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739733
Entry
103739733         CDS       T03372                                 

Gene name
Bak1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01524  Platinum drug resistance
ngi04141  Protein processing in endoplasmic reticulum
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05160  Hepatitis C
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103739733 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103739733 (Bak1)
   04215 Apoptosis - multiple species
    103739733 (Bak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739733 (Bak1)
   05202 Transcriptional misregulation in cancer
    103739733 (Bak1)
   05206 MicroRNAs in cancer
    103739733 (Bak1)
   05203 Viral carcinogenesis
    103739733 (Bak1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103739733 (Bak1)
   05212 Pancreatic cancer
    103739733 (Bak1)
   05225 Hepatocellular carcinoma
    103739733 (Bak1)
   05226 Gastric cancer
    103739733 (Bak1)
   05214 Glioma
    103739733 (Bak1)
   05216 Thyroid cancer
    103739733 (Bak1)
   05220 Chronic myeloid leukemia
    103739733 (Bak1)
   05217 Basal cell carcinoma
    103739733 (Bak1)
   05218 Melanoma
    103739733 (Bak1)
   05213 Endometrial cancer
    103739733 (Bak1)
   05224 Breast cancer
    103739733 (Bak1)
   05222 Small cell lung cancer
    103739733 (Bak1)
   05223 Non-small cell lung cancer
    103739733 (Bak1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    103739733 (Bak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103739733 (Bak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103739733 (Bak1)
   05160 Hepatitis C
    103739733 (Bak1)
   05164 Influenza A
    103739733 (Bak1)
   05162 Measles
    103739733 (Bak1)
   05168 Herpes simplex virus 1 infection
    103739733 (Bak1)
   05163 Human cytomegalovirus infection
    103739733 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103739733 (Bak1)
   05169 Epstein-Barr virus infection
    103739733 (Bak1)
   05165 Human papillomavirus infection
    103739733 (Bak1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103739733 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ngi03029]
    103739733 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ngi02000]
    103739733 (Bak1)
Mitochondrial biogenesis [BR:ngi03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    103739733 (Bak1)
Transporters [BR:ngi02000]
 Other transporters
  Pores ion channels [TC:1]
   103739733 (Bak1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 Syntaxin-5_N
Other DBs
NCBI-GeneID: 103739733
NCBI-ProteinID: XP_008838432
LinkDB
Position
Un
AA seq 210 aa
MASGQGPGPPGDGCGDPPSPSEQQVAQDTEEVFRSYVFHLHQREQETQGAAAPVDPEMDT
LPLEPNSILGQVGRQLAVIGDDINRRYDSEFQSLLEQLQPTASNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGKVTCFLADIILHHCIARWIAQRGGWVAALN
FRCRDPVLTVIAILGVVLVGQYVVQRFFRS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcatctgggcaaggaccaggtccaccgggagacgggtgtggagatcccccttcccct
tctgagcagcaggtggcccaggacacagaggaggtctttcgaagctatgtttttcacctt
caccagcgggaacaagagacccagggggcagctgcccctgttgaccctgagatggacacc
ttgcccctagaacccaacagcatcctggggcaggtgggtcggcagctagccgtcattgga
gatgatattaaccgacgctacgactcggagttccagagcttgctggagcagctgcagcct
acagccagcaacgcctatgaactgttcaccaagattgcttccagtctatttaagagtggt
atcagctggggccgtgtggtggctctcctgggttttggctatcgcctggccctgtatgtc
tatcagcgtggtttgaccggcttcctgggcaaggtgacctgctttctggcagacatcata
cttcaccattgcatcgcccgctggattgcacagaggggcggctgggtagcagccctgaat
tttcgctgcagagaccccgtcctgactgtgatagcaattttgggcgtggttctggtgggc
cagtatgtggtacaaagattcttcagatcatga

DBGET integrated database retrieval system