KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740099
Entry
103740099         CDS       T03372                                 

Gene name
Bcl2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04064  NF-kappa B signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04115  p53 signaling pathway
ngi04140  Autophagy - animal
ngi04141  Protein processing in endoplasmic reticulum
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi04217  Necroptosis
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04340  Hedgehog signaling pathway
ngi04510  Focal adhesion
ngi04621  NOD-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04915  Estrogen signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05014  Amyotrophic lateral sclerosis
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05162  Measles
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05215  Prostate cancer
ngi05222  Small cell lung cancer
ngi05226  Gastric cancer
ngi05417  Lipid and atherosclerosis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103740099 (Bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    103740099 (Bcl2)
   04630 JAK-STAT signaling pathway
    103740099 (Bcl2)
   04064 NF-kappa B signaling pathway
    103740099 (Bcl2)
   04066 HIF-1 signaling pathway
    103740099 (Bcl2)
   04071 Sphingolipid signaling pathway
    103740099 (Bcl2)
   04151 PI3K-Akt signaling pathway
    103740099 (Bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103740099 (Bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    103740099 (Bcl2)
   04215 Apoptosis - multiple species
    103740099 (Bcl2)
   04217 Necroptosis
    103740099 (Bcl2)
   04115 p53 signaling pathway
    103740099 (Bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103740099 (Bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103740099 (Bcl2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103740099 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    103740099 (Bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103740099 (Bcl2)
  09156 Nervous system
   04725 Cholinergic synapse
    103740099 (Bcl2)
   04722 Neurotrophin signaling pathway
    103740099 (Bcl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103740099 (Bcl2)
   05206 MicroRNAs in cancer
    103740099 (Bcl2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103740099 (Bcl2)
   05226 Gastric cancer
    103740099 (Bcl2)
   05215 Prostate cancer
    103740099 (Bcl2)
   05222 Small cell lung cancer
    103740099 (Bcl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103740099 (Bcl2)
   05161 Hepatitis B
    103740099 (Bcl2)
   05162 Measles
    103740099 (Bcl2)
   05168 Herpes simplex virus 1 infection
    103740099 (Bcl2)
   05169 Epstein-Barr virus infection
    103740099 (Bcl2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103740099 (Bcl2)
   05152 Tuberculosis
    103740099 (Bcl2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103740099 (Bcl2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103740099 (Bcl2)
   05022 Pathways of neurodegeneration - multiple diseases
    103740099 (Bcl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103740099 (Bcl2)
   05418 Fluid shear stress and atherosclerosis
    103740099 (Bcl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103740099 (Bcl2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103740099 (Bcl2)
   01524 Platinum drug resistance
    103740099 (Bcl2)
   01522 Endocrine resistance
    103740099 (Bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103740099 (Bcl2)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103740099 (Bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 103740099
NCBI-ProteinID: XP_008838876
LinkDB
Position
Un
AA seq 236 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGATPAPGIFSSLPGSNPTAA
VHQDPAARTSPPRLPAAMAGQALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFVTVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTDYLNR
HLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcgcacgccggcagaacagggtatgataaccgggagattgtgatgaagtacatccac
tataagctgtcacagaggggctacgaatgggatgctggagatgcggacgccgcgcccctg
ggggccacccccgccccgggcatcttttcttccttgcctgggagcaacccaaccgccgct
gtgcaccaggacccagccgccaggacctcgccgccgcgcctcccggctgcaatggctggg
caggcgctcagcccggtgccacctgtggtccacctgaccctccgccaggctggggatgac
ttctcccgtcgttaccgccgcgacttcgcagagatgtccagccagctgcacctgacgccc
ttcaccgcgaggggacgcttcgtcacggtggtggaggagctcttcagggatggggtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
agggagatgtcaccgctggtggacaacatcgccctctggatgaccgactacctgaaccgg
cacctgcacacctggatccaggataacggaggctgggatgcctttgtggaactgtatgga
cccagtgtgcggcccctgtttgacttctcttggctgtctctgaagaccctgctcagtctg
gccctggtaggggcctgcatcaccctgggtgcctatttgggccacaagtga

DBGET integrated database retrieval system