KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740143
Entry
103740143         CDS       T03372                                 

Gene name
Fhl1
Definition
(RefSeq) four and a half LIM domains 1
  KO
K14365  four and a half LIM domains protein 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740143 (Fhl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ngi04990]
    103740143 (Fhl1)
Domain-containing proteins not elsewhere classified [BR:ngi04990]
 LIM domain-containing proteins
  FHL family proteins
   103740143 (Fhl1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 103740143
NCBI-ProteinID: XP_008838917
LinkDB
Position
Un
AA seq 339 aa
MASHRHSGPSSYKVGTMSEKFDCHYCRDPLQGKKYVEKEGRHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRYWHDTCFRCVKCLHPLASETFVSKEGKIFCNKCATREDSPKCKGC
FKAIVAGDQNVEYKGTVWHKDCFICSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPHGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttctcatagacattcaggtccctccagctataaggtgggcaccatgtctgagaag
tttgactgccactactgcagggaccccttgcaggggaagaaatatgtggagaaggaaggc
cgccactgctgcctgaagtgctttgacaagttctgcgccaacacctgtgtggaatgccgc
aagcctataggtgcagactccaaggaggtgcactataagaaccgctactggcatgacacc
tgcttccgttgtgtcaagtgtcttcaccccttggccagcgagacctttgtgtccaaggaa
ggcaagatcttctgcaacaagtgtgccactcgggaggactcccccaagtgcaaagggtgc
ttcaaggccattgtggcaggagaccagaacgtggagtacaagggcaccgtctggcacaaa
gactgcttcatctgcagcaactgcaagcaagtcatcgggaccggaagcttcttccctaaa
ggggaggacttctactgtgtgacttgccacgagaccaagtttgccaagcattgcgtgaaa
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgag
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcatggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system