KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740252
Entry
103740252         CDS       T03372                                 

Gene name
Aim2
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04621  NOD-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103740252 (Aim2)
   04623 Cytosolic DNA-sensing pathway
    103740252 (Aim2)
SSDB
Motif
Pfam: HIN PYRIN Fucokinase
Other DBs
NCBI-GeneID: 103740252
NCBI-ProteinID: XP_008839068
LinkDB
Position
Un
AA seq 350 aa
MESKYKEMLLLTGLDNITEEELQRFKFFLPDKFKLAKSKVAAANRIELADLMIQSVGAAS
AVNRTILIFQKLNFMQVAKCLQEEKEKVDNKCKPNPKNGTKQVEKCQTEAHPVVSATMRE
DGIKKPSTEVSPPAKPQKKQMVAKQESIGSSLQQGPLTVLVLKAMKPFVFETQGRKQKMF
HATVATEREFFFVKVFNIQLKDKFTPKRIIIISNYHWHSGYLEVDSSSIVIDDEPDHQVS
VPKHIIRKAGETPKINKLQSQPHGTIVNGVFVVQKKTEEKDSVLYDVNDNTGEMAVLVLG
NQSKLKCEEGDKLRLTFFEVSKCGEELQLISGPHSFLKVIKAKKNPQRLR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggagagtaagtacaaggagatgctgctgctgacaggactggataacatcacggaggag
gaactgcaaaggttcaagttcttccttccagataagtttaagctcgccaagagcaaagtg
gcggctgcaaacaggattgagttagcggacctgatgattcaaagcgtgggtgcagcatct
gcggtgaacaggaccattctcattttccagaagttgaattttatgcaggtagcaaaatgt
cttcaggaagagaaggagaaagttgataacaaatgcaagccaaatccaaagaatggaaca
aagcaagtagaaaaatgtcaaactgaagctcatcctgttgtctctgccaccatgagagaa
gacggcatcaagaaaccctctacagaagtctctcctccagctaagcctcagaaaaagcag
atggtcgccaagcaggaatccatcggaagcagtctgcagcaaggccctctgacagtgttg
gtgctaaaagcaatgaagcccttcgtgtttgagacccagggaaggaagcaaaagatgttt
catgctacagtagctacggagagggaattcttttttgtaaaagtttttaatatacagctg
aaagataaatttaccccaaagagaataattataatatcaaattatcattggcacagtggt
tacctggaagtggacagttcttcgattgtgattgatgatgaacctgaccaccaggtcagt
gtcccaaagcacattatcagaaaagctggggaaactcccaagattaataagcttcaatct
cagccccatggaacaattgtgaatggggtatttgtagttcagaagaaaacagaggaaaaa
gatagtgtgttatatgatgtaaatgacaacacaggggagatggcggtgttggtgcttgga
aaccagagcaaactaaaatgtgaagaaggagataaacttcgacttacattctttgaggtg
tcaaaatgtggagaggaactacagctgatatctggaccccacagcttccttaaggttatt
aaggccaaaaaaaacccccaaagactgcgatga

DBGET integrated database retrieval system