KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740454
Entry
103740454         CDS       T03372                                 

Gene name
Lif
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740454 (Lif)
   04668 TNF signaling pathway
    103740454 (Lif)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740454 (Lif)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103740454 (Lif)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103740454 (Lif)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103740454 (Lif)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 103740454
NCBI-ProteinID: XP_008839292
LinkDB
Position
Un
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAASPLPITPVNATCATRHPCHGNLMNQIKNQLAQLNGSAN
ALFISYYTAQGEPFPNNLDKLCGPNMTDFPPFHANGTEKAKLVELYRLVAYLGASLGNVT
RDQKILNPNALSLHSKLNATTDTMRGLLSNVLCRLCNKYHVGHVDVTYGPDTAGKDAFQK
KKLGCQLLGTYKQVISLVAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggccgcaggagttgtgcccttgctgctggttctgcactggaaacacggg
gcagcgagcccccttcccatcacccctgttaatgctacctgtgccacacgccacccatgt
catggcaacctcatgaatcagatcaagaaccaattggctcagctcaatggcagtgccaat
gccctcttcatttcctattatacagctcagggggagccattccccaacaacctcgacaag
ctgtgtggacccaacatgacggacttcccacccttccatgccaatggcacagaaaaggcc
aagctggtggagctgtatcgtttggtcgcatacctgggtgcctccctgggcaacgtcacc
cgggatcagaagatcctgaaccccaatgccctgagcctccacagcaagctcaatgccacc
acagacaccatgcggggcctcctcagcaatgtgctttgtcgcctgtgcaacaagtaccat
gtgggccacgtggacgtgacctatggccctgacaccgcaggcaaggatgctttccaaaag
aaaaagctgggctgccagctcctggggacgtacaagcaagtcattagcctggtggcccag
gccttctag

DBGET integrated database retrieval system