KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740483
Entry
103740483         CDS       T03372                                 

Gene name
Osm
Definition
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740483 (Osm)
   04151 PI3K-Akt signaling pathway
    103740483 (Osm)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740483 (Osm)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103740483 (Osm)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103740483 (Osm)
SSDB
Motif
Pfam: LIF_OSM Apolipo_F
Other DBs
NCBI-GeneID: 103740483
NCBI-ProteinID: XP_008839346
LinkDB
Position
Un
AA seq 239 aa
MQAQFPQKTLLSLVLSLLLLSAALAMPGCSSSYQMLLSQLQRLANDTEDPRSLAEPYMHH
QSLNTTTLRKSCTEHPAAFPSEDALRALSKLDFLHTIDTMLGQVQHRVEALKQQFVRTQN
FPQLENAEYKIRGIRNNVYCMSWLLRRSQKTLEPTQTSSRALLSPAPTSDTFQAKLDSCR
FLWGYHSFMGSVGRVFSEWGDSLSRSRRHSPRRALHKRAHGFRHSRSSQRPMPRSQLPW
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcaggcacagttcccacagaagactctgctcagtctagtcctcagcctcctgctcctg
agcgcggcattggctatgcctggctgttccagctcttaccagatgctcctcagccagctg
cagagactggcaaacgacacagaggaccccagatcactcgcagagccatatatgcaccac
caaagcttgaacaccacaactctgaggaagtcctgcacagagcaccctgcagccttccca
agtgaggatgccctgcgggcactgagcaagctggacttcttgcacaccatcgacaccatg
ctgggccaagtccagcaccgagtggaggctttaaagcagcaatttgtgaggactcagaac
ttcccgcagctggagaatgctgagtacaagatccggggcatccgaaacaatgtgtactgc
atgagctggctgctccgcagatcccagaagacacttgaacccacacagacaagctctagg
gccttgttatcccctgccccaacatcagacacctttcaggccaagctggacagctgccgc
ttcctgtgggggtaccactccttcatgggctcagtggggcgggttttcagtgagtggggg
gacagtttgagccgcagccggagacacagcccacgacgggccctgcacaagagagctcac
gggttcagacactccaggagcagccagaggcccatgcccaggagtcagcttccctggtag

DBGET integrated database retrieval system