KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740624Help
Entry
103740624         CDS       T03372                                 

Gene name
Pfkm
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00010  Glycolysis / Gluconeogenesis
ngi00030  Pentose phosphate pathway
ngi00051  Fructose and mannose metabolism
ngi00052  Galactose metabolism
ngi01100  Metabolic pathways
ngi01200  Carbon metabolism
ngi01230  Biosynthesis of amino acids
ngi03018  RNA degradation
ngi04152  AMPK signaling pathway
ngi05230  Central carbon metabolism in cancer
Module
ngi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103740624 (Pfkm)
   00030 Pentose phosphate pathway
    103740624 (Pfkm)
   00051 Fructose and mannose metabolism
    103740624 (Pfkm)
   00052 Galactose metabolism
    103740624 (Pfkm)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103740624 (Pfkm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103740624 (Pfkm)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103740624 (Pfkm)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103740624 (Pfkm)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103740624 (Pfkm)
Messenger RNA biogenesis [BR:ngi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103740624 (Pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 103740624
NCBI-ProteinID: XP_008839508
LinkDB All DBs
Position
Un
AA seq 780 aa AA seqDB search
MTQEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLNDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLTETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVSKGGLHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKNFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSI
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHISRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggaagagcaccatgcagccaaaaccctggggatcggcaaagccatcgcggtg
ttaacctctggtggcgatgcccaaggtatgaatgctgccgtccgggctgtggttcgagtt
ggtatctttacgggtgcccgtgtcttctttgtccatgagggttaccaaggcctggtggat
ggtggagagcacatcagggaggccacctgggaaagcgtttccatgatgcttcagctggga
ggcacagtgattggaagtgcccgttgcaaggactttcgagagcgagaaggacgactccga
gctgcccacaacctggtgaagcgtgggatcaccaatctgtgtgtcattgggggtgatggc
agcctcactggggcagacactttccgttcagaatggagtgacttgctgaatgacctccag
aaagctggtaagatcacagctgaagaggccacaaaatctagctacctgaacattgtgggt
ctggttggctcaattgacaatgacttctgtggcactgatatgaccattggcactgactct
gccctgcaccggatagtagagattgtagatgccatcaccaccactgctcagagccaccag
aggacatttgtgttagaagtgatgggccgccactgtggatacctggcccttgtcacctct
ctctcctgtggggctgactgggtttttattcctgaatgtccaccggatgatgactgggag
gagcacctttgtcgccggctcactgagacgaggactcgtggctctcgtctcaacatcatc
attgtcgctgagggtgccatcgacaagaatgggaaaccaatcacctcagaggacatcaag
aacctggtggtaaagcgtctgggatatgacacccgggtcactgttttggggcatgtgcag
cggggtgggacaccatcagcgtttgaccggatcctgggcagcaggatgggtgtggaagcg
gtgatggcacttttggaggggactccagataccccagcctgtgtggtaagcctttctggt
aaccaggctgtgcgtctgcccctcatggagtgtgtccaggtgaccaaagatgtgaccaag
gccatggatgagaagaggtttgatgaagccataaagctcagaggccggagcttcatgaac
aactgggaggtatacaagcttctagctcatgtcagacccccagtctctaagggcggtttg
cacacagtggctgtgatgaatgtgggggctcccgccgcaggcatgaatgctgcagttcgc
tccactgtgaggattggccttatccagggcaaccgagtgctggttgtacatgacggcttt
gagggcctggccaaaggtcagattgaagaagccggttggagctatgttgggggctggact
ggccaaggtggttccaaacttggcactaaaaggaccctgcccaagaagaactttgaacag
atcagtgccaacataactaagtttaacattcagggccttgtcatcattgggggctttgag
gcttacacagggggcctggagctgatggagggcaggaagcagtttgatgagctctgcatc
ccatttgtggtcattcctgccactgtttccaacaatgtccctgggtcagacttcagcatt
ggggccgacacagccctcaataccatctgcacgacttgtgatcgaatcaagcagtcagca
gcgggcaccaagcgtcgagtatttatcattgagactatgggtggctactgtggctatttg
gccaccatggcaggactggcagctggggcggatgctgcctatatttttgaggagcccttc
accattcgagacctccaggcaaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aaaagaggcttggtgttaaggaatgagaagtgcaatgagaactacaccactgacttcatc
ttcaacctgtactctgaggagggcaagggcatcttcgacagcaggaagaatgtgctcggc
cacatgcagcagggaggaagcccaactccctttgacaggaattttgccactaagatgggt
gctaaggctatgaactggatgtctgggaaaatcaaagagagttatcgtaatggacggatc
tttgccaatactccagactcaggttgtgttctggggatgcgtaagagggccttggtcttt
caaccagtggcggagctgaaggaccagacagattttgagcaccgaatccccaaggaacag
tggtggctgaagctgaggcccatcctcaaaatcctggccaagtatgagattgatttggac
acctctgaccacgcccacctggagcatatctctcggaagcggtctggggaagctgctgtc
tag

DBGET integrated database retrieval system