KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740849
Entry
103740849         CDS       T03372                                 

Gene name
Il6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01523  Antifolate resistance
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi04659  Th17 cell differentiation
ngi04668  TNF signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05134  Legionellosis
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05144  Malaria
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05321  Inflammatory bowel disease
ngi05323  Rheumatoid arthritis
ngi05332  Graft-versus-host disease
ngi05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740849 (Il6)
   04668 TNF signaling pathway
    103740849 (Il6)
   04066 HIF-1 signaling pathway
    103740849 (Il6)
   04068 FoxO signaling pathway
    103740849 (Il6)
   04151 PI3K-Akt signaling pathway
    103740849 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740849 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103740849 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103740849 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103740849 (Il6)
   04620 Toll-like receptor signaling pathway
    103740849 (Il6)
   04621 NOD-like receptor signaling pathway
    103740849 (Il6)
   04623 Cytosolic DNA-sensing pathway
    103740849 (Il6)
   04625 C-type lectin receptor signaling pathway
    103740849 (Il6)
   04659 Th17 cell differentiation
    103740849 (Il6)
   04657 IL-17 signaling pathway
    103740849 (Il6)
   04672 Intestinal immune network for IgA production
    103740849 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103740849 (Il6)
   05202 Transcriptional misregulation in cancer
    103740849 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103740849 (Il6)
   05321 Inflammatory bowel disease
    103740849 (Il6)
   05332 Graft-versus-host disease
    103740849 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103740849 (Il6)
   05020 Prion disease
    103740849 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    103740849 (Il6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103740849 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103740849 (Il6)
   04931 Insulin resistance
    103740849 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103740849 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103740849 (Il6)
   05135 Yersinia infection
    103740849 (Il6)
   05133 Pertussis
    103740849 (Il6)
   05134 Legionellosis
    103740849 (Il6)
   05152 Tuberculosis
    103740849 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103740849 (Il6)
   05161 Hepatitis B
    103740849 (Il6)
   05171 Coronavirus disease - COVID-19
    103740849 (Il6)
   05164 Influenza A
    103740849 (Il6)
   05162 Measles
    103740849 (Il6)
   05168 Herpes simplex virus 1 infection
    103740849 (Il6)
   05163 Human cytomegalovirus infection
    103740849 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103740849 (Il6)
   05169 Epstein-Barr virus infection
    103740849 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103740849 (Il6)
   05144 Malaria
    103740849 (Il6)
   05142 Chagas disease
    103740849 (Il6)
   05143 African trypanosomiasis
    103740849 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103740849 (Il6)
   01523 Antifolate resistance
    103740849 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103740849 (Il6)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103740849 (Il6)
SSDB
Motif
Pfam: IL6 IL23 IL11 GCSF
Other DBs
NCBI-GeneID: 103740849
NCBI-ProteinID: XP_008839768
LinkDB
Position
Un
AA seq 212 aa
MKFLSTRTLHPLAFLGLLLVTATAFPASQVREEASTDDTTPNRPAYTTPQKMEGLISYVI
GEISEIRTELCDHDENCLNNDEAFLANNLEPPRLTIKDGCFQTGYNRETCLLKVTSGLLE
YQVYLEYIQGKLKDTRQEKVKNVQANVKTLIRILKQEIKNLSKVIFPSPTANASLLEKLD
TQNEWHKTMAIHFILRQLENFLTTTIRAIREN
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaagttcctctccacaagaaccctccatcctcttgccttcttggggctgctcctggtg
acggccactgccttccccgcctcgcaagtccgggaagaagctagcacagatgataccacc
cccaacagaccagcatataccactccacaaaagatggaaggcctgatttcatatgtcatc
ggggaaatctcggaaataagaactgagttgtgtgatcatgatgagaattgcttgaacaat
gacgaggcctttttagcaaacaatctggagcctccaaggctaacaataaaagatggatgt
ttccaaactggatacaatcgggaaacttgcctgttgaaagtcacctctggtcttctggag
taccaggtctacctggagtacatccagggcaagttgaaagatactcggcaagaaaaagtc
aaaaacgtgcaggccaatgtcaagaccctaattcggatcttgaaacaagagataaaaaat
ctgagtaaagtcatcttccctagcccaactgccaatgccagcctgctggaaaagctggat
acacagaacgagtggcacaagaccatggccatccacttcatcctgcggcaacttgagaat
ttcctaacgaccaccataagggctattcgggaaaactaa

DBGET integrated database retrieval system