KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741127
Entry
103741127         CDS       T03372                                 

Gene name
Fgfr3
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05219  Bladder cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103741127 (Fgfr3)
   04014 Ras signaling pathway
    103741127 (Fgfr3)
   04015 Rap1 signaling pathway
    103741127 (Fgfr3)
   04020 Calcium signaling pathway
    103741127 (Fgfr3)
   04151 PI3K-Akt signaling pathway
    103741127 (Fgfr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103741127 (Fgfr3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103741127 (Fgfr3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103741127 (Fgfr3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741127 (Fgfr3)
   05206 MicroRNAs in cancer
    103741127 (Fgfr3)
   05230 Central carbon metabolism in cancer
    103741127 (Fgfr3)
  09162 Cancer: specific types
   05219 Bladder cancer
    103741127 (Fgfr3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103741127 (Fgfr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103741127 (Fgfr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103741127 (Fgfr3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103741127 (Fgfr3)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   103741127 (Fgfr3)
CD molecules [BR:ngi04090]
 Proteins
  103741127 (Fgfr3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig FGFR3_TM V-set C2-set_2 Pkinase_fungal DUF1533 RIO1
Other DBs
NCBI-GeneID: 103741127
NCBI-ProteinID: XP_008840051
LinkDB
Position
Un
AA seq 806 aa
MGAPACALTLCVAVALAVVAGAASESPGTEQRLVRRAAEVPEPEPSQEEQVAFGSGDTVE
LSCHPPGGAPTGPTVWVKDGTGLVTSHRILVGPQRLQVLNASHEDAGAYSYRQRLTQRVL
CHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNP
TPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYT
LDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDG
TPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPVEEE
LMEAGEAGSVYAGILSYGVGLFLFILVVATVTLCRLRSPPKKGLGSPTVHKVSRFPLKRQ
VTVSLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGE
GCFGQVVMAEAIGIDKDRTARPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREYLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSS
SSSGDDSVFTHDLLPPAPPSNGGPRT
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgggagccccggcctgcgcgctaacgctctgcgtggccgtggccctggcggtggtggcc
ggagctgcctccgaatccccaggcacagagcagcgccttgtgcggagagccgcagaggtg
ccagagcctgagcctagccaggaggagcaggtggcctttggcagtggggataccgtggag
ctgagctgccacccacctgggggtgcccctacaggccccaccgtctgggtcaaggatggc
acagggttggtgacctcccatcgaatcctggtggggccccagcgtctgcaggtgctgaat
gcctcccacgaggatgcaggagcctacagctatcggcagcgtctcactcagcgcgtcctg
tgccactttagtgtgcgtgtcacagatgccccgtcctcaggagatgatgaagatggggaa
gatgtggctgaagacacaggggccccttactggactcggccagagaggatggataagaaa
ctgctggctgtaccggccgccaacactgttcgcttccgctgcccggctgctggcaacccc
actccctccatctcctggctgaagaatggcaaggaattccgtggggagcatcgcataggg
ggcatcaagctgcggcaccagcagtggagcctggtcatggagagtgtggtgccctccgac
cgtggcaactatacctgtgtggtggagaacaagttcggcagcatccgacagacatatacc
ctggatgtgttggaacgttctccacaccggcccatccttcaggcggggctgccggccaac
cagacagctgttctgggcagcgatgtggagttccactgtaaggtgtacagtgatgcacag
ccacacatccagtggctgaaacacgtggaggtgaatggcagcaaggtgggccccgatggc
acgccctacgtcactgtgctcaagacggcaggcgctaacaccaccgacaaggagctagag
gttctgtcattgcacaatgtcacctttgaggacgcgggggagtacacctgcctggcaggc
aattctatcgggttttcccatcactctgcgtggctggtggtgctgccagttgaggaggag
ctgatggaggctggtgaggctggcagcgtgtacgcgggcatcctcagctacggggtgggc
ctcttcctcttcatcctggtggtggcgactgtgacactctgtcgcctgcgcagtcccccc
aagaagggcctgggctccccaactgtgcacaaggtctctcgcttcccacttaagcgacag
gtaacagtgtccttggagtccaactcatccatgaactccaacacacccctggtccgcatc
gcccggctgtcctcgggagaaggtcctgtcttggccaatgtttctgaacttgaactgcct
gctgaccccaagtgggaactatccaggacccggttgacgctgggcaagcctctcggggag
ggctgctttggccaggttgtcatggcggaggccatcggcattgacaaggaccgcacagcc
aggccggtcactgtggctgtgaagatgctgaaagatgatgccactgacaaggacctgtcg
gacctggtgtctgagatggagatgatgaagatgattggcaagcacaagaacataatcaac
ctgctgggggcctgcacgcagggtgggcccctgtatgtgctggtggagtatgcggccaag
ggcaatctgcgggagtacctgcgggcacggcgccctccaggcatggactactccttcgat
gcatgcaggctgcctgaagagcagctcacttgcaaggatctggtgtcctgtgcctaccag
gtcgcccggggcatggagtacctggcctcgcagaagtgcatccacagagacttggctgcc
cggaacgtcctggtgaccgaggacaatgtgatgaagattgcagacttcggcttggcccgt
gatgtgcacaacctggactactacaagaagactacgaacggccggctacctgtgaagtgg
atggcaccagaggccctgtttgaccgggtctatacccaccagagtgacgtctggtccttt
ggggtcctgctctgggagatctttactctggggggctcaccataccctggcatcccagtg
gaagagcttttcaagctgttgaaagagggccaccgcatggacaaaccagccaactgcaca
cacgacctgtacatgatcatgcgggaatgctggcatgcagtcccctcccagaggcccact
ttcaagcagctggtagaagacctggaccgcatcctcactgtgacatccactgacgagtac
ctggacctatctgtgccttttgagcagtactcaccaggtggccaggatactcccagctcc
agctcctcgggggacgactctgtgttcacccacgacctgctgcccccagcaccacccagt
aatgggggacctcggacgtga

DBGET integrated database retrieval system