KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741948
Entry
103741948         CDS       T03372                                 

Gene name
Gsk3b
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04012  ErbB signaling pathway
ngi04062  Chemokine signaling pathway
ngi04110  Cell cycle
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04310  Wnt signaling pathway
ngi04340  Hedgehog signaling pathway
ngi04360  Axon guidance
ngi04390  Hippo signaling pathway
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04657  IL-17 signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04728  Dopaminergic synapse
ngi04910  Insulin signaling pathway
ngi04916  Melanogenesis
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05135  Yersinia infection
ngi05160  Hepatitis C
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103741948 (Gsk3b)
   04310 Wnt signaling pathway
    103741948 (Gsk3b)
   04340 Hedgehog signaling pathway
    103741948 (Gsk3b)
   04390 Hippo signaling pathway
    103741948 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    103741948 (Gsk3b)
   04150 mTOR signaling pathway
    103741948 (Gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103741948 (Gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103741948 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    103741948 (Gsk3b)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103741948 (Gsk3b)
   04657 IL-17 signaling pathway
    103741948 (Gsk3b)
   04662 B cell receptor signaling pathway
    103741948 (Gsk3b)
   04062 Chemokine signaling pathway
    103741948 (Gsk3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103741948 (Gsk3b)
   04917 Prolactin signaling pathway
    103741948 (Gsk3b)
   04935 Growth hormone synthesis, secretion and action
    103741948 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    103741948 (Gsk3b)
   04916 Melanogenesis
    103741948 (Gsk3b)
  09156 Nervous system
   04728 Dopaminergic synapse
    103741948 (Gsk3b)
   04722 Neurotrophin signaling pathway
    103741948 (Gsk3b)
  09158 Development and regeneration
   04360 Axon guidance
    103741948 (Gsk3b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741948 (Gsk3b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103741948 (Gsk3b)
   05225 Hepatocellular carcinoma
    103741948 (Gsk3b)
   05226 Gastric cancer
    103741948 (Gsk3b)
   05217 Basal cell carcinoma
    103741948 (Gsk3b)
   05215 Prostate cancer
    103741948 (Gsk3b)
   05213 Endometrial cancer
    103741948 (Gsk3b)
   05224 Breast cancer
    103741948 (Gsk3b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103741948 (Gsk3b)
   05020 Prion disease
    103741948 (Gsk3b)
   05022 Pathways of neurodegeneration - multiple diseases
    103741948 (Gsk3b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103741948 (Gsk3b)
   04931 Insulin resistance
    103741948 (Gsk3b)
   04934 Cushing syndrome
    103741948 (Gsk3b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103741948 (Gsk3b)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103741948 (Gsk3b)
   05162 Measles
    103741948 (Gsk3b)
   05163 Human cytomegalovirus infection
    103741948 (Gsk3b)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103741948 (Gsk3b)
   05165 Human papillomavirus infection
    103741948 (Gsk3b)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103741948 (Gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103741948 (Gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103741948 (Gsk3b)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     103741948 (Gsk3b)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   103741948 (Gsk3b)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103741948 (Gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 103741948
NCBI-ProteinID: XP_008841124
LinkDB
Position
Un
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTPGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQATASTPTNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcggcttttggcagtatgaaagttagcagagataaagatggcagcaaggtaaccacagtg
gtggcaactcctggacagggtccagacaggccccaagaagtcagttacacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagttttgcaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagttcgattgcgttatttcttctactcaagtggt
gagaagaaagatgaggtctaccttaatctggtgctggactatgttccggaaacagtgtac
cgagttgccagacactatagtcgagccaaacagacactccctgtgatctatgtcaagttg
tatatgtatcagctgttcagaagtttagcctatatccattcctttggaatttgccatcga
gatattaaacctcagaacctcttgttggatcctgatacagctgtattaaaactctgtgac
tttggaagtgcaaagcaactggtccgaggagaacccaatgtttcatatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggttgtgtgttggctgagttgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
atcagagaaatgaacccaaactacacagaattcaaattcccgcaaatcaaggcacatcct
tggacaaaggattcgtcaggaacaggacatttcaccccaggagttcgggtcttccgaccc
cgaactccacccgaggcaattgcattatgtagccgtctactggagtatacaccaactgcc
cggttaacaccgctggaagcttgtgcgcattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagatacacctgcactcttcaactttaccactcaagagctc
tcgagtaatccacctctggccaccatccttattcctcctcatgctcggattcaagcaact
gcttcaacccctacaaatgccacagcagcctcagatgctaatgctggagaccgtggacag
accaataatgccgcttctgcatcagcttccaactccacttga

DBGET integrated database retrieval system