KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742203
Entry
103742203         CDS       T03372                                 

Gene name
Axin2
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103742203 (Axin2)
   04390 Hippo signaling pathway
    103742203 (Axin2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103742203 (Axin2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742203 (Axin2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103742203 (Axin2)
   05225 Hepatocellular carcinoma
    103742203 (Axin2)
   05226 Gastric cancer
    103742203 (Axin2)
   05217 Basal cell carcinoma
    103742203 (Axin2)
   05213 Endometrial cancer
    103742203 (Axin2)
   05224 Breast cancer
    103742203 (Axin2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103742203 (Axin2)
   05022 Pathways of neurodegeneration - multiple diseases
    103742203 (Axin2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103742203 (Axin2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103742203 (Axin2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103742203 (Axin2)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103742203 (Axin2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind DUF4827
Other DBs
NCBI-GeneID: 103742203
NCBI-ProteinID: XP_008841424
LinkDB
Position
Un
AA seq 839 aa
MSSAVLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKGQAAKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQA
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCVDFK
CKLSPTVVGLTSKTLRATASVRSTEAAENGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRMGSKKQLQREMHRSAKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALALSSRDGAP
IQHPLSLLPSGSYEDDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHQQYHS
VLPLGGKLPPVATCPLLGGKGFLSKQMTKHVHHHYIHHHAVPKTREEIEAEATQRVRCLC
PGGTDYYCYSKCKSHPKAPEPLPGEQFGGSRGSTLPKRNVKGTELGLTLPAREGGVSNGA
GAPQLPGEEGDRSQDVWQWMLESERQTKPKPHSAQSAKKTYPLESARTSPGERVSRHHLW
GGSGHPRSTPRAHPFTQDPAVPPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVANQQRDR
SHSATGQAGATSFSNPSLAPEDHKEPKKVAGVHVLQASELVVTYFFCGEEIPYRRMLKAQ
SLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgagtagcgctgtgctggtgacgcgcctcccagatcccagtagcagcttccgcgaggat
gctccgcggcccccggttccgggagaagaaggggagaccccaccttgccaacccagtgtg
ggcaagggccaggccgccaaacccatgcctgtctcctccaatgccaggcggaatgaagat
gggctgggagagcctgaggggagggcgtcccctgattcccctctgaccaggtggaccaag
tccttgcactccttgttgggcgaccaggacggtgcatacctctttcggactttcctggag
agggagaaatgtgtggatactttggacttctggtttgcctgtaatggatttaggcagatg
aacctcaaggataccaaaactttgcgagtagccaaagccatctataagaggtacattgag
aacaacagcatcgtctccaagcagctgaaacctgccaccaagacctacatacgagatggc
atcaagaagcagcagatcgactccatcatgtttgaccaggcacagactgagatccaggca
gtgatggaggaaaatgcctaccagatgtttttgacttctgacatatacctcgagtatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactgggaagcctaaaggtc
ttgtgtggctacctccccaccttgaatgaagaagaggagtggacttgtgtagatttcaag
tgcaaactttcacctactgtggttggcttaacgagcaaaactctgcgggccacagccagt
gtgagatccacggaagccgctgaaaatggatacaggtcctttaagaggagcgaccccgtt
aacccctatcatgtaggttccggctacgtctttgcgccagccaccagcgccaatgacagc
gagatatccagtgacgcactaactgatgattccatgtccatgacagacagcagtgtagat
ggaatccctccttaccgcatggggagtaagaaacagctccagagagaaatgcaccgaagt
gcgaaggccaacggccaagtatctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacgcccgtggaacctgctgcctttgccgctgaactcatctcgaggctggagaag
ctgaaactggagctggagagccgccacagcttggaggagcggctgcagcagatccgagag
gatgaagaaaaggaggggtccgagcaggcactggcactgagctcacgggatggagcaccc
atccaacaccccctgtccctcctgccctctggcagctatgaagatgacccgcagaccatt
ctggatgaccacctgtccagggtcctcaagacccctggttgccagtcacctggtgtgggc
cgctatagcccacgctcccgctcccctgaccaccaccaccaccaccagcagtaccactct
gtcctcccgctggggggcaagctgccccctgtggctacctgcccactccttgggggcaaa
ggcttcctgagcaagcagatgacgaaacatgttcatcaccactacatccaccaccacgcc
gtccccaagaccagggaggagatcgaagcagaagcaacgcagagggtgcgctgcctctgc
cctgggggcaccgactattactgctactcaaaatgcaagagccaccccaaggccccagag
cccttgccaggggagcagtttggcggcagcagaggtagtaccttgcccaaacgaaatgtg
aaaggcacggaactgggcctgacactgccggccagggaaggaggggtatccaatggagca
ggggccccacagcttcctggggaggaaggagaccggtcacaggatgtctggcaatggatg
ctggagagcgagcggcagaccaagcccaagcctcatagtgcccaaagtgcaaaaaagact
taccccttggagtctgcccgcacatccccgggcgaacgagtcagccgacaccatctgtgg
ggaggcagtggacacccccgctcgacaccccgggcccacccatttacccaagaccctgcg
gtgcctcccctgaccccacccaacactttggcgcagctggaagaagcctgcagaaggctg
gcagaggtgtcaaagccccaaaagcagcggtgctgcgtggccaatcagcagagggacagg
agccattcagccacaggtcaggcaggagccacatccttctccaacccaagcctggctcca
gaagatcacaaagagccaaagaaagtggcaggtgtccatgtgcttcaggccagtgagttg
gttgtcacttactttttctgtggcgaagaaattccatacaggaggatgctgaaggctcag
agcttgaccctgggccactttaaagagcagctcagcaaaaagggaaattataggtattac
ttcaaaaaagcaagtgatgagtttgcctgtggagcagtgttcgaggagatctgggatgat
gagacagtgctcccaatgtatgaaggcaggatactgggcaaagtggagaggatcgattga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748223
Entry
103748223         CDS       T03372                                 

Gene name
Axin1
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103748223 (Axin1)
   04390 Hippo signaling pathway
    103748223 (Axin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103748223 (Axin1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748223 (Axin1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103748223 (Axin1)
   05225 Hepatocellular carcinoma
    103748223 (Axin1)
   05226 Gastric cancer
    103748223 (Axin1)
   05217 Basal cell carcinoma
    103748223 (Axin1)
   05213 Endometrial cancer
    103748223 (Axin1)
   05224 Breast cancer
    103748223 (Axin1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103748223 (Axin1)
   05022 Pathways of neurodegeneration - multiple diseases
    103748223 (Axin1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103748223 (Axin1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103748223 (Axin1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103748223 (Axin1)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103748223 (Axin1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin
Other DBs
NCBI-GeneID: 103748223
NCBI-ProteinID: XP_008849032
LinkDB
Position
Un
AA seq 864 aa
MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSADPRPVSHSFCSGKGASTKSETSTAT
PRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CSGFRKLEPCNSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPT
LNEDEEWKCDQDADEDDGRDSVPPSRLTQKLLLETAAPRASSSRRYSEGRELRYGSWREP
INPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDLPSGPMGTSHKLPSVPAWHHFPPRYMDMGCSGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSGHVAKTTVLGGTASGHGKHMPKSGSKLDTAGLHHHRHVHHHVHH
SSARPKDQMEAEATRRVQSSFSWGPEIHGHVKPRSYSESTGIILSAGDLAFSGKASAPSK
RNTKKADSGKNTSAEVLGATEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGMRKQQAHE
SSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEE
KRASKLPSKQRYVQAVMQRGRAFVRPACVPVLSVVPAVSDLELSETETKSQRKAGGGSVP
PCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFE
EVREDEAVLPVFEEKIIGKVEKVD
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgaatgtccaggagcagggtttccccttggacctcggagcgagtttcaccgaagatgcc
ccccgacctccagtgcctggcgaggagggagaactggtatctgctgacccgaggcctgtc
agccacagtttctgctctgggaaaggtgccagcactaaaagtgagacctcgacagccacc
ccaaggcgttcagatctggatctggggtacgagcctgagggcagtgcctctcccacccca
ccatacttgaggtgggccgagtcactgcattccttactggatgaccaagatgggatcagc
ctgttcaggactttcctgaagcaggagggctgtgctgacctgttggacttctggtttgcc
tgcagtggcttcaggaagcttgagccctgcaactcaaatgaggagaagaggctgaagctg
gcaagagccatctaccgaaagtatatcctggatagcaatggcattgtgtctaggcaaacc
aagccagctaccaagagcttcataaaggactgtgtcatgaagcaacagattgatcctgcc
atgtttgaccaggcccagacagaaatccagtccaccatggaagagaatacctacccttcc
ttcctcaagtctgacatttatttggaatacacaaggacaggctcagagagcccgaaggtc
tgcagtgaccagagctcagggtctgggacagggaagggcatgtctggatacctgcccact
ttgaatgaagatgaggaatggaaatgtgaccaagatgcagatgaggatgatggcagagac
tctgtccctcccagcaggctcacccagaagctgctcttggagactgctgccccgagggcc
tcctcaagtagacggtacagcgaaggcagagagctcaggtatggatcgtggagggagccc
attaacccctactatgtcaactctggctatgccctggccccagccaccagcgccaatgac
agtgaacagcagagcctgtccagtgatgctgacactctatctctcacagacagtagtgtg
gatggaatccccccatacaggatccgtaaacagcaccgaagggaaatgcaagagagtgtc
caagtcaatgggcgggtacctctacctcacattcctcgcacttaccgaatgccaaaggag
atccgggtggagccacagaagtttgctgaagagctcattcatcgcctagaggctgtccag
cgcactcgggaggctgaagagaagctggaggagcggctgaagcgtgtacggatggaggaa
gaaggtgaggatggtgacctgccttctggccccatggggacaagtcacaagctgccttct
gtcccagcctggcaccacttcccaccccgctacatggacatgggctgctctggactgcgg
gatgcccatgaagagaaccctgagagcatcctggatgagcatgtgcaacgggtcatgagg
acacctggctgccagtcacctggtccaggccatcgctcccctgacagtgggcatgtggct
aagactacagtgctggggggtacagcttctggccatgggaagcacatgcctaagtctggg
tcaaagctggatacagctggcctgcaccatcacaggcatgtccatcaccatgttcaccac
agttcagccaggcccaaggatcagatggaagctgaagccacccgcagggtccagagcagc
ttctcatggggcccagaaatacatggccatgtcaaaccccgcagctattcagaaagcaca
ggcatcatcctcagtgctggggacttggcctttagtggtaaggccagtgcaccctccaaa
cgaaacactaagaaggcagactctgggaagaacaccagtgctgaggtactgggtgccact
gaggatgcagagaagaaccagaagattatgcagtggatcattgagggagagaaggagatc
agtaggcaccggaaggcgggccatgggtcttctgggatgaggaagcaacaggcccatgag
agttccaggcccttgtccattgagcgtcctggggcagtgcacccctgggtcagcgctcag
ctccggaactctgtccagccttctcatctcttcatccaagatcctacaatgccacccaac
ccagcccccaatcccctgacccagctggaagaagctcgtcggcgtttggaggaagaggag
aagagagccagtaagctaccttccaagcagaggtatgtgcaggcagtcatgcagcgggga
cgcgcctttgtcaggccagcatgtgtgccagtgctgagtgtggtaccagccgtgtcggac
ttggaactctccgagacagagacaaaatcacagaggaaggcaggtggcggaagtgtacca
ccatgtgacagcatcgtcgtggcctactatttctgtggggaacccattccctatcggacc
ctagtgaggggccgtgcagttaccctgggccagttcaaggagctgctaaccaagaagggg
agctacagatactacttcaagaaagtgagtgacgagtttgactgtggtgtggtatttgaa
gaagtgcgggaggatgaggcagtcctgcctgtctttgaagagaagataatcggcaaggtg
gaaaaggtggactga

DBGET integrated database retrieval system