KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742208
Entry
103742208         CDS       T03372                                 

Gene name
Gna13
Definition
(RefSeq) G protein subunit alpha 13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04611  Platelet activation
ngi04730  Long-term depression
ngi04810  Regulation of actin cytoskeleton
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103742208 (Gna13)
   04072 Phospholipase D signaling pathway
    103742208 (Gna13)
   04071 Sphingolipid signaling pathway
    103742208 (Gna13)
   04022 cGMP-PKG signaling pathway
    103742208 (Gna13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103742208 (Gna13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103742208 (Gna13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103742208 (Gna13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103742208 (Gna13)
  09156 Nervous system
   04730 Long-term depression
    103742208 (Gna13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742208 (Gna13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103742208 (Gna13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103742208 (Gna13)
   04031 GTP-binding proteins [BR:ngi04031]
    103742208 (Gna13)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103742208 (Gna13)
  Exosomal proteins of colorectal cancer cells
   103742208 (Gna13)
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    103742208 (Gna13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 103742208
NCBI-ProteinID: XP_008841429
LinkDB
Position
Un
AA seq 377 aa
MADFLPSRSVLSVCFPGCMLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNENQLHGD
KLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggatttcctgccgtcgcgctccgtgctgtccgtgtgcttcccgggctgcatgttg
acgagcggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtcgcgg
gagaagacctacgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcgtatcatccacggccaggacttcgaccagcgcgcg
cgtgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggta
gatgcccgagagaagcttcatattccttggggagataatgaaaaccagctccatggagac
aagttgatggcttttgatacccgtgcccccatggctgcccagggaatggtggaaacacgc
gtttttttacagtatcttcctgctataagagctttatgggccgacagtggcatacagaat
gcctacgaccgccgtcgagaattccagctgggtgaatctgtaaaatatttcctggataac
ttggataaactcggagtaccggattacattccctcacagcaagatattctgcttgccaga
agacccaccaaaggcatccacgagtatgactttgaaattaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagaggtcagagcggaaacgatggtttgagtgctttgacagtgtg
acgtcaatacttttccttgtttcctcaagtgagtttgaccaggtgctcatggaggatcga
ctgaccaatcgccttacagagtctctgaacatttttgaaacaattgtcaataaccgggtt
ttcagcaatgtctctataatcctcttcttaaacaagacagacttgcttgaggagaaagtg
caaattgtgagcatcaaagactatttcctagaatttgaaggggatccacactgcttaaga
gacgtccaaaaatttctggtggaatgtttccggaacaaacgccgggaccagcagcagaag
cccttataccaccacttcaccactgcaatcaacacggagaacatccgcctggttttccgt
gatgtgaaagatactattcttcacgacaacctcaaacagctcatgctccagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748670
Entry
103748670         CDS       T03372                                 

Gene name
Gna12
Definition
(RefSeq) G protein subunit alpha 12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04730  Long-term depression
ngi04810  Regulation of actin cytoskeleton
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748670 (Gna12)
   04072 Phospholipase D signaling pathway
    103748670 (Gna12)
   04071 Sphingolipid signaling pathway
    103748670 (Gna12)
   04022 cGMP-PKG signaling pathway
    103748670 (Gna12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103748670 (Gna12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103748670 (Gna12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103748670 (Gna12)
  09156 Nervous system
   04730 Long-term depression
    103748670 (Gna12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748670 (Gna12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103748670 (Gna12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103748670 (Gna12)
   04031 GTP-binding proteins [BR:ngi04031]
    103748670 (Gna12)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   103748670 (Gna12)
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    103748670 (Gna12)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 103748670
NCBI-ProteinID: XP_008849610
LinkDB
Position
Un
AA seq 305 aa
MRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHSENEKHGMFLMAFEN
KAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFP
SKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSE
YDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKVKSVSIKKHFPD
FKGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENIRFVFHAVKDTILQENLK
DIMLQ
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcgcatcatccacggccgcgagttcgatcagaaggcgctgctggagttccgagacacc
atcttcgacaacatcctcaagggctcgagagtgctcgtggatgcgcgtgataagcttggc
attccctggcaacactctgagaatgagaagcatgggatgtttctgatggccttcgagaac
aaggcagggctgcctgtggagcccgccaccttccagctctacgtgccagccctgagtgcg
ctctggagagactccgggatcagggaagccttcagccgcaggagcgagttccagctgggt
gagtcagtgaagtacttcctggataacttggaccgaatcggccagctgaactacttcccc
agtaagcaagacatcctgttggccagaaaggccaccaaggggattgtggaacatgacttc
gttatcaagaagatcccgtttaagatggtagacgtgggcggccagcgctcacagcgccag
aagtggttccagtgtttcgatgggatcacgtccatcctgttcatggtgtcctcgagtgag
tacgaccaggtgctcatggaggacaggcgcaccaaccggctggtggagtccatgaacatc
tttgagaccatcgtcaacaacaagctgtttttcaacgtctccatcatcctttttctcaac
aagatggacctcctagtggagaaggtgaagtccgtgagcatcaagaagcactttccagat
ttcaaaggcgacccgcaccggctggaggacgtgcagcgctacctggtgcagtgcttcgac
cgcaagcggcgaaaccgcagcaagcccctgttccaccacttcaccaccgccatagacacc
gagaacatccgctttgtgttccatgctgtaaaggacaccatcctgcaggaaaacctgaag
gacatcatgttgcagtga

DBGET integrated database retrieval system