KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742345
Entry
103742345         CDS       T03372                                 

Gene name
Dll1
Definition
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103742345 (Dll1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103742345 (Dll1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742345 (Dll1)
  09162 Cancer: specific types
   05224 Breast cancer
    103742345 (Dll1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103742345 (Dll1)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_CA EGF_3 cEGF ECSCR EGF_2
Other DBs
NCBI-GeneID: 103742345
NCBI-ProteinID: XP_008841623
LinkDB
Position
Un
AA seq 722 aa
MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCHGGSGPPCACRTFFR
VCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGSGIDSAFSNPIRFPFGFTWPGTFS
LIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDE
HYYGEGCSVFCRPRDDAFGHFTCGERGEKVCDPGWKGQYCTEPICLPGCDDQHGFCDKPG
ECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNG
ATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCRNGGSCTDLEDSYSCTCPPGFYGK
VCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCSSSPCSNGAKCV
DLVNAYLCRCQVGFSGRHCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGRNCSAP
VSRCEHAPCHNGATCHQRGQRYVCECAQGYGGPNCQFLLPEPPQGPMVVDLSEKHVEGQG
GPFPWVAVCAGVVLVLMLLLGCAAVVVCIRLRLQKRQLPADPCRGETETMNNLANCQREK
DVSISIIGATQIKNTNKKADFHGDHGSDKSSFKARYPTVDYNLVRDLKGDETTIRDAHSK
HDTKCQPQGSTGEEKGTSTLRGGEDPDRKRPESVYSTSKDTKYQSVYVLSEEKDECVIAT
EV
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgggtcgtcggagtgcgctagccctcgccgtcgtctcggccctgctgtgccaggtctgg
agctccggcgtgtttgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccacgggggctcaggcccgccgtgcgcctgcaggaccttcttccgc
gtatgcctcaagcactaccaggccagcgtgtctccggagcctccctgcacctatggcagc
gcggtcacaccagtgctgggcgtcgattccttcagcttgccggatggctcgggcatcgac
tctgcgttcagcaaccccatccgtttccctttcggcttcacctggccaggcaccttctct
ctgatcattgaagccctccacacagattctccggatgatctcgcaacagaaaacccagaa
aggctcatcagccgcctcaccacacagaggcatctgactgtgggtgaggagtggtctcag
gatctgcacagtagtggccgcacagacctccgatactcttatcgctttgtgtgtgatgaa
cactactatggagaaggttgctctgtgttctgccgaccccgggatgatgcttttggccac
ttcacctgtggggagagaggcgagaaggtgtgcgatcctggctggaaagggcagtactgc
actgaaccaatctgtctgccagggtgtgatgaccaacatggattttgtgacaagccaggg
gaatgcaagtgcagagtcggctggcagggccgctactgtgatgagtgcatccgataccca
ggctgtctccatggtacctgccagcagccctggcagtgtaactgccaggaaggctggggg
ggacttttctgcaaccaggacctgaactactgcacacaccataaaccctgtaggaatgga
gccacctgcaccaacacaggccaggggagctatacatgctcctgccgacctgggtataca
ggcgccaactgtgagctggaggttgatgagtgtgccccaagcccctgcagaaatggaggg
agctgcacggacctcgaggacagctattcttgcacctgtcctcctggattctatggcaag
gtctgcgagctgagtgccatgacttgtgcagatggtccctgcttcaacggggggcggtgt
tcagacaaccctgatggaggctacacctgtcattgccctttgggcttctccggcttcaac
tgtgagaagaagatggatctctgcagctcttccccctgttctaatggtgccaagtgtgtg
gacctcgtcaatgcctacctgtgccgctgccaggttggcttctctgggaggcactgtgag
gacaatgtggatgactgcgcctcctccccatgtgcaaatgggggcacctgccgggacagt
gtgaatgacttctcctgcacctgcccacctggttacacaggcaggaattgcagtgcccct
gtcagcaggtgtgagcatgcaccctgccataatggggccacctgccaccagaggggccag
cgctatgtgtgcgaatgtgcccagggctatggcggtcccaactgccagttcctgctccct
gagccaccacagggccccatggtagtggaccttagcgagaagcatgtggagggccagggt
gggcccttcccctgggtggctgtgtgtgctggggtggtgcttgtcctcatgctgctgctg
ggctgtgctgctgtggtggtctgcatccggctgaggctacagaagcgccagctcccagct
gacccctgccggggagagacggagaccatgaacaacctggccaattgccagcgtgagaaa
gatgtttccattagcatcattggggctacacagatcaagaacaccaacaagaaggcggac
tttcatggggaccatggttctgacaagagtagctttaaggcccgataccccactgtggac
tataacctcgtgcgagacctcaagggagatgaaaccaccatcagggatgcacacagcaag
catgacaccaagtgccagccacagggctctacaggagaagagaagggcacctcaacactc
aggggtggggaagaccctgacagaaaaaggcctgagtctgtctattccacttcaaaggac
accaagtaccagtcggtgtatgttctatctgaggagaaggacgagtgtgtcatagcaact
gaggtgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744923
Entry
103744923         CDS       T03372                                 

Gene name
Dll4
Definition
(RefSeq) delta like canonical Notch ligand 4
  KO
K06051  delta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103744923 (Dll4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103744923 (Dll4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103744923 (Dll4)
  09162 Cancer: specific types
   05224 Breast cancer
    103744923 (Dll4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103744923 (Dll4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 EGF_3 EGF_CA
Other DBs
NCBI-GeneID: 103744923
NCBI-ProteinID: XP_008845002
LinkDB
Position
Un
AA seq 685 aa
MPAASRSASRWALLLLAVLWLQRAAGSGIFQLQLQEFANERGVMASGQPCEPRCRTFFRV
CLMHFQTVVSPGPCTFGSVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKITIQRSLAVGQNWLGEEQNSSLTRLRYSYRVICSDNYY
GDSCSRLCKKRNDHFGHYVCQPDGSLSCLPGWTGEYCDQPICLSGCHEQNGYCSKPAECL
CRPGWQGPLCNECTPHNGCRHGTCSIPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQENGYHCLCPPSYYGQHCE
HSTLTCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRTCRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGPVCTCPAGFSGRRCEVRIT
NDACASRPCFNGATCYTGLSPDNFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLVV
VLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPASQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTVPGKHPHSDKSLGEKVPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgccggctgcgtcccggagcgcctctcgctgggcgctgctactgctggcggtactttgg
ctgcagcgcgcggcgggctccggcatcttccagttgcagctgcaggagttcgccaacgag
cgtggtgtaatggccagtgggcagccgtgcgagccccgctgccggactttcttccgcgtc
tgccttatgcacttccagacagttgtctcgcccgggccctgcaccttcggcagcgtctct
acgccggtattgggcaccaactcctttgccgtcagggacgacagtagtggtggtggtcgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttttcactcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagatgcactcatc
agcaagatcaccatccagcgctcccttgccgtgggtcagaattggttaggggaagagcaa
aacagctccctcacgaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacagctgttctcgtctgtgcaagaagcgaaatgaccacttcggccactacgtgtgc
caaccagatggcagcctgtcctgcctgcctggttggactggggaatactgcgatcagcct
atctgtctttctggctgtcatgaacagaatggctactgcagcaagccagcagagtgcctc
tgccgcccgggttggcagggccccctgtgcaatgaatgtacccctcacaatggctgtcgc
catggcacctgcagcatcccttggcagtgtacctgtgacgagggctggggtggcctgttc
tgtgaccaagatctcaactactgcacacaccactccccatgcaagaatggagcaacgtgc
tccaacagcgggcagcggagctacacctgcacctgtcgcccaggctacactggcgtggac
tgtgagctagaactcagcgagtgtgacagtaacccctgtcgcaatggagggagctgtaag
gaccaggagaatggctaccactgcctgtgtccccccagctactatggccagcactgtgaa
cacagtactttgacctgtgctgactcaccctgcttcaatgggggatcttgccgggagcgc
aaccaaggggccagttatgcctgtgaatgcccccctaacttcactggctccaactgtgag
aaaaaagtggacaggtgcaccagcaacccatgtgccaatgggggccagtgcttgaacaga
ggtccaagccgcacctgccgctgccgaccaggattcacaggcacccactgtgaactccac
atcagcgactgtgcccgcagcccctgtgctcatgggggcacttgccatgatttggagaat
gggcccgtgtgcacctgccctgctggcttttctggcaggcgctgcgaggtgcgaataact
aatgatgcctgtgcctccaggccctgcttcaacggtgccacctgctacactggcctctcc
ccggacaacttcgtctgcaactgcccttacggctttgtgggcagccgttgcgagttcccc
gtgggcttgccacccagttttccctgggttgctgtctccctgggtgtggggctggtggtg
gtgctggtgttgctgggcatggtggcagtggctgtgcggcagctgcgacttcgccggcca
gatgatggcagcagggaggccatgaacaacttgtcggacttccagaaggacaacctaatc
cctgcttcccagctcaagaacactaaccagaagaaggagctggaagtggactgtggcctg
gacaagtctaactgtgggaaacagcagaaccacacattggactataatctggccccagga
cccctggggcgggggaccgtgcctgggaagcatcctcacagtgacaagagcttgggagag
aaggtgccactgcggttacacagtgaaaagccagagtgtcgaatatcagcgatatgctcc
cccagggactccatgtaccagtcagtgtgtttgatatcagaagagaggaatgaatgtgtc
attgccacagaggtataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750746
Entry
103750746         CDS       T03372                                 

Gene name
Dll3
Definition
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  delta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103750746 (Dll3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103750746 (Dll3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750746 (Dll3)
  09162 Cancer: specific types
   05224 Breast cancer
    103750746 (Dll3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103750746 (Dll3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 DSL
Other DBs
NCBI-GeneID: 103750746
NCBI-ProteinID: XP_008852188
LinkDB
Position
Un
AA seq 588 aa
MVSLQMSPQMSQLWSQTVILALLLPQAGPTGVFELQIHSFRSGPDPGAPQSPCSARGPCR
LFFRVCLKPGVSREAAESPCALGAALSARGPSYPEQPAVPAALPLPDGLVRVPFRDAWPG
TFSLIIETWREQLGEQAGGPAWSLLARVAGQRRLAAGTPWASDVQRAGAWELRFSYRARC
EPPAVGTACARLCRSSSPSRCGPGLRPCAPFEDQCEAPAVCRAGCSSEHGYCEQPDECQC
LEGWTGPLCTVPVSASSCLNPGGSASASTGCLVPAPGPCDGNPCANGGSCSETPSSFECA
CPRGFYGHRCEVSGVTCADGPCFNGGLCVGGEDPESAYICHCPPGFQGSNCEKRVDRCSL
QPCHNGGLCLDLGHTLRCRCRAGFAGPRCEHDLEDCSRRACANGGTCVEGGGARRCSCAL
GFGGRDCRERSDPCATRPCAHGGRCYAHFSGLVCACPPGYMGARCEFAVRPDGAGALPAA
PRGLRQADPQLFLLPPALGLLVAVGLAGAALWLVHSRSRGLGRDTGAHLLSGTREPSVHT
LPDALNNLRTQDGSGDGPSSLVDWNHPEDGDPPSIYVTPAPSVYAREA
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggtgtccctgcagatgtccccgcagatgtcccagctttggtcccagacggtgattttg
gcgctcctccttccccaggctgggccgactggtgtcttcgagctgcagatccattctttc
cggtcgggaccagacccgggggccccgcaatccccttgcagcgcccgaggcccttgccgt
ctgttcttcagggtctgcttgaagcctggggtctcccgcgaggccgccgagtccccgtgc
gccctgggcgcagcgctcagtgcgcgcggcccctcctaccccgagcagcccgcagtgcct
gcagccctgccgctgcccgacgggctggtgcgcgtgcccttccgagacgcctggcccggc
accttctccctcatcattgagacctggagagagcagctgggggagcaggctggagggccc
gcctggagcttactggcacgcgtggccggccagagacgcctggcggctgggaccccgtgg
gccagcgacgtgcagcgcgcaggcgcgtgggagctgcgcttctcgtatcgcgcgcgctgt
gagccaccagccgtcggaaccgcgtgcgcgcgcctgtgtcgctcgagcagcccctcgcgg
tgcggcccgggactgcgcccctgcgcgcccttcgaggaccagtgcgaggccccggcagta
tgtcgagcaggctgcagctccgagcatggctactgtgaacagccggatgagtgccagtgc
ctggagggctggactgggcccctctgcacggtccctgtctctgccagcagctgcctgaac
cctgggggctcagcttctgctagcacgggatgcctggtaccagcgcctgggccctgtgat
gggaacccatgtgccaacgggggcagctgcagcgaaacacccagctcctttgaatgtgcc
tgtccccggggattctacgggcatcgatgtgaggtgagcggggtgacatgcgcagatgga
ccctgcttcaatggtggcttgtgtgttggtggagaagaccctgagtctgcctacatctgt
cactgcccacccggtttccaaggctctaactgtgagaagagggtggaccggtgtagtctg
cagccatgccataacggcggcctctgtctggacctgggccacaccctgcgctgtcgctgc
cgcgcgggcttcgcgggtccccgctgcgaacacgacctggaggactgctcgcgccgcgcc
tgcgccaacggcggcacgtgcgtggagggcgggggcgcgcgccgctgctcgtgcgcgctg
ggcttcggcggccgcgactgtcgggagcgctcagatccttgcgccacgcggccctgcgcg
cacggcggccgctgctacgcccacttctcaggtctcgtgtgcgcctgtccacccggctac
atgggcgcgcgctgcgagtttgccgttcgccccgacggcgcaggcgcgctgcccgcggcc
cctcggggcctgaggcaggctgatccgcagctcttccttttgcccccggctttgggcctg
ctggtggccgtgggcttggccggcgctgcgctctggttggtccactcgcgcagtcgaggc
cttggccgggatactggggcccacttgctgtcggggacccgggagccgtcggtgcacacg
ctccctgatgcactcaataacctgaggacgcaggatggttccggagatggcccgagctca
ttggtggactggaatcacccagaagatggagaccctccgtcaatttatgtcacacctgca
ccttcggtctatgctcgggaggcctga

DBGET integrated database retrieval system