KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742429
Entry
103742429         CDS       T03372                                 

Gene name
Cxcl8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04218  Cellular senescence
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05134  Legionellosis
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05144  Malaria
ngi05146  Amoebiasis
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05219  Bladder cancer
ngi05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103742429 (Cxcl8)
   04072 Phospholipase D signaling pathway
    103742429 (Cxcl8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103742429 (Cxcl8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103742429 (Cxcl8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103742429 (Cxcl8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103742429 (Cxcl8)
   04621 NOD-like receptor signaling pathway
    103742429 (Cxcl8)
   04622 RIG-I-like receptor signaling pathway
    103742429 (Cxcl8)
   04657 IL-17 signaling pathway
    103742429 (Cxcl8)
   04062 Chemokine signaling pathway
    103742429 (Cxcl8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742429 (Cxcl8)
   05202 Transcriptional misregulation in cancer
    103742429 (Cxcl8)
  09162 Cancer: specific types
   05219 Bladder cancer
    103742429 (Cxcl8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103742429 (Cxcl8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103742429 (Cxcl8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103742429 (Cxcl8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103742429 (Cxcl8)
   05135 Yersinia infection
    103742429 (Cxcl8)
   05133 Pertussis
    103742429 (Cxcl8)
   05134 Legionellosis
    103742429 (Cxcl8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103742429 (Cxcl8)
   05171 Coronavirus disease - COVID-19
    103742429 (Cxcl8)
   05164 Influenza A
    103742429 (Cxcl8)
   05163 Human cytomegalovirus infection
    103742429 (Cxcl8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103742429 (Cxcl8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103742429 (Cxcl8)
   05144 Malaria
    103742429 (Cxcl8)
   05142 Chagas disease
    103742429 (Cxcl8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103742429 (Cxcl8)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103742429 (Cxcl8)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Chemokines
   103742429 (Cxcl8)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Chemokines
   103742429 (Cxcl8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103742429
NCBI-ProteinID: XP_008841693
LinkDB
Position
Un
AA seq 95 aa
MTSKLAVALWATFLLSAAVCEATRSTAINAELRCQCKKTHSKSFNSRAIKGLTVIKGGPD
CQNTEIIIKLVSGRQFCLDPKKKWVQRVLELFVKR
NT seq 288 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgccctctgggcaacctttctgctctctgcagctgtgtgt
gaagctacacgttcaacagctattaatgcagaacttcgatgccagtgcaagaagactcat
tccaaatccttcaattccagagctatcaaaggactgacagtgattaaggggggcccagac
tgtcagaatacagaaatcatcataaagcttgtgagtggaagacagttctgtcttgatcct
aagaaaaagtgggtgcagagggttttggagttatttgtgaaaaggtaa

DBGET integrated database retrieval system