KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742505
Entry
103742505         CDS       T03372                                 

Gene name
Ddb2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03420  Nucleotide excision repair
ngi04115  p53 signaling pathway
ngi04120  Ubiquitin mediated proteolysis
ngi05161  Hepatitis B
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103742505 (Ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    103742505 (Ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    103742505 (Ddb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742505 (Ddb2)
   05202 Transcriptional misregulation in cancer
    103742505 (Ddb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103742505 (Ddb2)
   05212 Pancreatic cancer
    103742505 (Ddb2)
   05225 Hepatocellular carcinoma
    103742505 (Ddb2)
   05226 Gastric cancer
    103742505 (Ddb2)
   05214 Glioma
    103742505 (Ddb2)
   05216 Thyroid cancer
    103742505 (Ddb2)
   05220 Chronic myeloid leukemia
    103742505 (Ddb2)
   05217 Basal cell carcinoma
    103742505 (Ddb2)
   05218 Melanoma
    103742505 (Ddb2)
   05213 Endometrial cancer
    103742505 (Ddb2)
   05224 Breast cancer
    103742505 (Ddb2)
   05222 Small cell lung cancer
    103742505 (Ddb2)
   05223 Non-small cell lung cancer
    103742505 (Ddb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103742505 (Ddb2)
   05169 Epstein-Barr virus infection
    103742505 (Ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103742505 (Ddb2)
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103742505 (Ddb2)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     103742505 (Ddb2)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      103742505 (Ddb2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 103742505
NCBI-ProteinID: XP_008841793
LinkDB
Position
Un
AA seq 429 aa
MAPKKRPETQKPPDIAVRLKSKSVPSTRELEPATKKLYALNPGSSRRCDSCCLLAELANL
QVPSQSSIIRALHQQKLGRVTWPSLQQGLQKSFLQSLASYQVFQRVAPFDRRATSLAWHP
THPSTLAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITALKFNQLNTNQFFACSMEGTT
RLQDFKGNILRVFTSSNSCNVWFCSLDVSTKSQVLVTGDNVGHVILLNTDGKELWTLKMH
KKKVTHVALNPCCDWLLATASIDQTVKIWDLRQIRGKTSFLYSLPHRHPVNSACFSPDGA
RLLTTDQYSEIRVYSASQWDCPVSLICHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPNL
KSCIPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASAMGYHILIWSQE
EAGPQKEHE
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgtccagaaacccagaagccccccgacattgcggtacgcctcaag
agcaagagcgtcccaagtaccagagagctggagcccgcgaccaagaagttgtatgcgctg
aaccccggttccagcaggagatgtgactcatgttgccttttggcagagttggctaaccta
caggtcccttcacagagtagtatcatcagggctctccaccagcaaaaattgggcagagtc
acctggccatcactacagcagggtctccaaaagtcctttttgcagtctctggcttcttac
caggtattccaaagagttgccccctttgacaggcgggctacatccttggcctggcaccca
actcatcccagcaccctggctgtgggctccaaagggggagatatcttgctctggaacttt
ggcataaaggacaaacccaccttcattaaagggattggagctggaggaagcatcactgcg
ttgaagtttaaccagctgaataccaaccagttttttgcctgctcaatggagggaacaacc
aggctgcaagattttaaaggcaacattctccgagtttttaccagctcaaactcctgcaat
gtctggttttgcagcctggatgtttctaccaagagccaagtgctggtcacaggggacaat
gtaggacatgtgatactgctgaacacagatggcaaggagctttggactctgaaaatgcac
aaaaagaaagtaacccatgtggccttgaacccctgctgtgattggcttctggccacagcc
tccatagatcaaacagtgaaaatctgggacctgcgccagattagagggaaaaccagcttc
ctctattcactgcctcataggcatcctgtcaattcagcttgtttcagccctgatggagcc
aggctcctgactactgaccagtacagtgagattcgggtttactctgcctcccagtgggac
tgccccgtgagcctgatctgccaccctcaccgtcatttccagcacctcacacccatcaag
gcaacctggcatccacgatacaaccttattgttgtgggccgatacccagatcctaacctt
aaaagctgtatcccctatgagctaaggacaatagatgtgtttgatggtagctcggggaag
atgatgtgtcagctctatgacccgggatattctggtatcacttcgctcaatgagttcaat
cctatgggggacaccctggcctctgctatgggttatcatattcttatttggagccaggag
gaggctgggccacagaaagaacatgagtaa

DBGET integrated database retrieval system