KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742642
Entry
103742642         CDS       T03372                                 

Gene name
Egf
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05160  Hepatitis C
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05226  Gastric cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103742642 (Egf)
   04012 ErbB signaling pathway
    103742642 (Egf)
   04014 Ras signaling pathway
    103742642 (Egf)
   04015 Rap1 signaling pathway
    103742642 (Egf)
   04630 JAK-STAT signaling pathway
    103742642 (Egf)
   04066 HIF-1 signaling pathway
    103742642 (Egf)
   04068 FoxO signaling pathway
    103742642 (Egf)
   04020 Calcium signaling pathway
    103742642 (Egf)
   04072 Phospholipase D signaling pathway
    103742642 (Egf)
   04151 PI3K-Akt signaling pathway
    103742642 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103742642 (Egf)
   04540 Gap junction
    103742642 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103742642 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742642 (Egf)
   05231 Choline metabolism in cancer
    103742642 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103742642 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103742642 (Egf)
   05212 Pancreatic cancer
    103742642 (Egf)
   05226 Gastric cancer
    103742642 (Egf)
   05214 Glioma
    103742642 (Egf)
   05218 Melanoma
    103742642 (Egf)
   05219 Bladder cancer
    103742642 (Egf)
   05215 Prostate cancer
    103742642 (Egf)
   05213 Endometrial cancer
    103742642 (Egf)
   05224 Breast cancer
    103742642 (Egf)
   05223 Non-small cell lung cancer
    103742642 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103742642 (Egf)
   05165 Human papillomavirus infection
    103742642 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103742642 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103742642 (Egf)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103742642 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b EGF_3 EGF_CA EGF cEGF FXa_inhibition SGL MTABC_N hEGF Tr-sialidase_C
Other DBs
NCBI-GeneID: 103742642
NCBI-ProteinID: XP_017656270
LinkDB
Position
Un
AA seq 774 aa
MQKLNRKLQSAGRVTSASNLKRVLNAVIFEIRLTGPQPFLLFANSQDIRHMHFDGTDYGT
LLSQQMGMVFALDYDPVESKIYFSHTALKLIERANMDGSQRERLIQGVDRPEGLAVDWIG
RRVYWTNSGKSLIEGSYLSGKNRQIIIKENVFQPRGIAVHPKAKRLFWTDTGRNPRIESS
SLQGSGRLVIVSSDLLEPSGITIDYLTDTLYWCDTKQSVIEMADLDGSKRRRLAQNDVGQ
PFAVAVFEDHLWFSDLTISSVIRVNKRTGENRVRLRGGMLKPSSLLVVHPLAKPGADPCL
HENGGCEHVCQGSFGAAQCSCHEGFMTAQDGKTCLSLEGHQTLAGNNTDLSNVVTPLDNL
TKGGASEDDNTECQRGLVSEIMVSGMNQFYQDDCAPGGCGRHAQCVSEGENATCQCLEGF
AGDGKLCSDIDECALGNMNCPAVSSQCINTEGGYVCRCSDGYEGDGIHCLDIDECQQGTH
ICGENANCTNTEGGYNCTCAGHPSAPGLTCPDSTLPSPLGEDGRHLVRNSYPGCPPSHDG
YCLHGGVCMYVEALDSYACNCVVGYIGERCQHRDLRWWGLRHAGQGQECNVTVVAVCVVV
LALLLLLGLWGAHYCRTQKQLLKNPKNPYEESSRDRSANRRAGTGAATSSCPQPWFVVLE
EHQDLKNGSLPMAGRNGQAVDAGLPSSLEPGPVHLTSWRQKPHIYGTGTKQGCXNPPSSD
KRPGFQVREGNVHLPLYREWPLAVGVEKLHPLQSADXSXQQRASDLPHXTEPIQ
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgcagaaattaaacaggaagctgcagtcagcaggaagagtcacaagtgcctccaatctg
aagcgtgttttaaatgcagtcatatttgaaattcggttaacaggaccacagccattttta
ctgtttgctaattctcaagacatccgacacatgcactttgatggaaccgattatggaact
ctgctcagccagcagatgggaatggtttttgctctggattatgaccccgtggaaagcaag
atatacttttcacatacagccttgaaattgatagagagagctaatatggatggttcccag
cgggaaaggcttatccagggtgtagacaggccagaaggtcttgctgtggactggattggc
cgaagagtctactggacaaacagtgggaaatctctcatagaaggcagttatttaagcgga
aagaaccgtcaaataatcatcaaggagaatgtctttcagccacgaggaattgctgttcat
ccaaaggccaagagattattctggacagatacagggagaaatcctcgaattgaaagctct
tcccttcaaggctctggtcggctggtgatagtaagctctgatctgttggagcctagtgga
atcactattgactacttaacagacactttgtattggtgtgataccaagcagtctgtgatc
gaaatggccgatctggatggttccaaacgccgaaggcttgcccagaatgatgtaggtcag
ccctttgcggtagctgtgtttgaggatcacctgtggttctcagatttgactatatcatcg
gtaataagggtgaacaagaggactggcgagaacagggtacgtctccgcggcggcatgctg
aagccttcatcactgcttgtggtccatccactggcaaaaccaggtgcagatccctgctta
catgagaatggaggctgcgaacacgtttgtcaagggagcttcggagctgcccagtgttca
tgtcatgaaggttttatgacagctcaggatgggaaaacgtgcctttccctggagggtcac
cagacactggccggcaataatactgatctaagtaatgtggtaacaccattggacaactta
acaaagggcggagcatcggaagatgacaacacagagtgtcagcgtgggcttgtgtctgaa
atcatggtgtcaggtatgaaccagttctatcaagatgactgtgcccctggaggatgtggc
aggcatgcccagtgtgtttcagagggagagaatgccacctgtcagtgtttggaaggattt
gctggggatggaaaactgtgttctgatatagacgagtgtgcgctgggaaacatgaactgt
cctgccgtctcatcccagtgcatcaatactgaaggtggctatgtctgccggtgctcagac
ggctatgaaggagacgggatccactgtctcgatattgacgagtgccagcaagggacgcac
atctgtggagagaatgccaactgcaccaacacggagggaggctacaactgcacctgtgct
ggccacccatctgcacctggactgacttgcccagactctaccttaccctctccccttggg
gaagatggccgccatctggtcagaaatagttacccaggatgccccccgtcacatgatggg
tactgcctccatgggggtgtgtgcatgtatgttgaagcattagacagctacgcatgcaac
tgtgtggtcggctacatcggggagcgatgtcagcaccgagacttgcgatggtggggactg
cgtcacgcgggccagggtcaggagtgcaacgtcaccgtggtggctgtctgtgtggtggtg
ctggccctgttgctcctcttgggactgtggggggctcactactgcaggactcagaaacag
ctattgaaaaacccaaagaatccttatgaagagtcgagcagagacagaagtgctaacagg
cgtgccggcactggggctgcaacgtcttcttgtccccaaccttggtttgtggtcctagaa
gaacaccaagacctcaagaatgggagtctgcctatggctggcaggaatggccaggcagtg
gatgctggcctgccttcctccctggagcctgggccagtgcatctgacttcatggagacag
aagccccacatatatggaacaggcacaaaacaaggctgtntgaatccgccatccagtgat
aaaagacctggtttccaggtcagggagggaaacgtccatctacccctctatagggaatgg
cctttggctgtgggggttgagaagctgcatcctctccagtcagctgactagtcatgacaa
caaagagcctcagatctcccacactaaacagagccaattcagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748570
Entry
103748570         CDS       T03372                                 

Gene name
Pdgfb
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05211  Renal cell carcinoma
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05231  Choline metabolism in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748570 (Pdgfb)
   04014 Ras signaling pathway
    103748570 (Pdgfb)
   04015 Rap1 signaling pathway
    103748570 (Pdgfb)
   04630 JAK-STAT signaling pathway
    103748570 (Pdgfb)
   04020 Calcium signaling pathway
    103748570 (Pdgfb)
   04072 Phospholipase D signaling pathway
    103748570 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    103748570 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103748570 (Pdgfb)
   04540 Gap junction
    103748570 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103748570 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748570 (Pdgfb)
   05206 MicroRNAs in cancer
    103748570 (Pdgfb)
   05231 Choline metabolism in cancer
    103748570 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    103748570 (Pdgfb)
   05218 Melanoma
    103748570 (Pdgfb)
   05211 Renal cell carcinoma
    103748570 (Pdgfb)
   05215 Prostate cancer
    103748570 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103748570 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103748570 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103748570 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103748570 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103748570 (Pdgfb)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103748570 (Pdgfb)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103748570 (Pdgfb)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 103748570
NCBI-ProteinID: XP_008849454
LinkDB
Position
Un
AA seq 242 aa
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDSVDEDQAEL
DLNMTRAHSGREPESSSRGRRSLGSLAAAEPAMIAECKTRTEVFEISRRLVDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCKATQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHVACKC
ETVVSARPVTRSPGTTQEHRAAKTPQTRVAIRTVRVRRPPKGKHRKFKHTHDKMALKETL
GA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgcctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcctgaagaactctatgaaatgctgagtgaccactccatccgctcc
tttgatgacctccagcggttgctgcacggagactccgtagatgaagaccaggccgagctg
gacctgaacatgacccgggcacactctggaagagaaccagaaagctcatctcgagggagg
aggagcttgggttccctcgcagccgcggaaccagccatgatcgccgagtgcaagacgcgc
acggaggtgttcgagatctcgcggcgcctggtcgaccgcaccaacgccaacttcctggtg
tggccaccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgcaaggccacgcaggtgcagctgcggccagtgcaggtgagaaagatagagattgtgcgg
aagaagccgacctttaagaaggccacagtgaccttggaggaccatgtggcctgcaagtgt
gagacggtggtatctgctcggcctgtgacccgaagtccggggacaacccaggaacatcga
gcagccaagacacctcagactcgggtggccattcggacagtgcgagtccgccggcccccc
aaagggaagcaccggaagttcaagcacacacatgacaagatggcactgaaggagaccctt
ggggcctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748699
Entry
103748699         CDS       T03372                                 

Gene name
Pdgfa
Definition
(RefSeq) platelet derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05231  Choline metabolism in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748699 (Pdgfa)
   04014 Ras signaling pathway
    103748699 (Pdgfa)
   04015 Rap1 signaling pathway
    103748699 (Pdgfa)
   04630 JAK-STAT signaling pathway
    103748699 (Pdgfa)
   04020 Calcium signaling pathway
    103748699 (Pdgfa)
   04072 Phospholipase D signaling pathway
    103748699 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    103748699 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103748699 (Pdgfa)
   04540 Gap junction
    103748699 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103748699 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748699 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    103748699 (Pdgfa)
   05206 MicroRNAs in cancer
    103748699 (Pdgfa)
   05231 Choline metabolism in cancer
    103748699 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    103748699 (Pdgfa)
   05218 Melanoma
    103748699 (Pdgfa)
   05215 Prostate cancer
    103748699 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103748699 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103748699 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103748699 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103748699 (Pdgfa)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103748699 (Pdgfa)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103748699 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 103748699
NCBI-ProteinID: XP_017658280
LinkDB
Position
Un
AA seq 211 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGADDALE
TSLRVHGSHATKHAPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEEPGRRRESGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctgctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagatcccccgtgagctgatcgagcggctggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggccgatgatgccttggag
acaagcctgagagtccatgggtcccatgctaccaagcatgcacccgagaagcggcctgtg
cccattcggaggaagagaagtattgaggaagccattcctgccgtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatccgccaactttctgatctgg
cccccgtgtgtggaggtgaagcgctgcacaggctgctgcaacaccagcagtgttaagtgc
cagccctcgcgggtccaccaccgcagtgtcaaggtggccaaagtggaatacgtcagaaag
aagccaaaattgaaagaggtccaggtgaggttagaggaacacctggagtgtgcgtgcgca
acctccaacctgaacccagaccaccgggaggaggagccgggaagacgtagggaatcaggt
aaaaagcggaaaagaaaaaggttaaaacccacctaa

DBGET integrated database retrieval system