KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743072
Entry
103743072         CDS       T03372                                 

Gene name
Hbegf
Definition
(RefSeq) heparin binding EGF like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05171  Coronavirus disease - COVID-19
ngi05205  Proteoglycans in cancer
ngi05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103743072 (Hbegf)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103743072 (Hbegf)
   04915 Estrogen signaling pathway
    103743072 (Hbegf)
   04928 Parathyroid hormone synthesis, secretion and action
    103743072 (Hbegf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103743072 (Hbegf)
  09162 Cancer: specific types
   05219 Bladder cancer
    103743072 (Hbegf)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103743072 (Hbegf)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103743072 (Hbegf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103743072 (Hbegf)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103743072 (Hbegf)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 103743072
NCBI-ProteinID: XP_008842497
LinkDB
Position
Un
AA seq 208 aa
MKPLPSVVLKVFLAAVLSALVTGESLERLRRGLAAATSNPDSPAESTDQLLPVGGGGARE
VQDLEEADVDLFRAGFSTKPQALATPTKEKYGKKKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYLKALRTPSCNCHPGYHGERCHGLTLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagccgctgccgtcggtggtgctgaaggtctttctggcagcagtgttgtctgcgctg
gtgacgggtgagagtctggagcggctccggagaggtctggcagctgcaaccagcaacccc
gattctccagctgaatccacagaccagctactacccgtgggaggtggtggtgctcgggaa
gtccaggacttggaagaggcagatgtggacctttttagagctggtttctccaccaagccg
caagcactagccacaccaaccaaagaaaagtatgggaaaaaaaagaagaaaggcaaagga
ttaggaaagaagagagacccatgtcttcggaaatataaggacttctgcatccatggagaa
tgcaaatatctgaaggctctccgtactccgtcatgcaactgccatccaggttatcatgga
gagaggtgtcatgggctgactctcccggtggagaaccgtttatatacatatgaccacact
actatcctagctgtggtggctgtggtgctgtcatctgtctgtctgctcgtcatagtgggg
cttctcatgtttaggtaccataggcgaggaggttatgatgtggaaaatgaagagaaagtg
aagttgggtatgactaattcccattga

DBGET integrated database retrieval system