KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743359
Entry
103743359         CDS       T03372                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04150  mTOR signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04350  TGF-beta signaling pathway
ngi04360  Axon guidance
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04530  Tight junction
ngi04611  Platelet activation
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04921  Oxytocin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04972  Pancreatic secretion
ngi05100  Bacterial invasion of epithelial cells
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103743359
   04015 Rap1 signaling pathway
    103743359
   04310 Wnt signaling pathway
    103743359
   04350 TGF-beta signaling pathway
    103743359
   04072 Phospholipase D signaling pathway
    103743359
   04071 Sphingolipid signaling pathway
    103743359
   04024 cAMP signaling pathway
    103743359
   04022 cGMP-PKG signaling pathway
    103743359
   04150 mTOR signaling pathway
    103743359
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103743359
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103743359
   04520 Adherens junction
    103743359
   04530 Tight junction
    103743359
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103743359
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103743359
   04621 NOD-like receptor signaling pathway
    103743359
   04625 C-type lectin receptor signaling pathway
    103743359
   04660 T cell receptor signaling pathway
    103743359
   04670 Leukocyte transendothelial migration
    103743359
   04062 Chemokine signaling pathway
    103743359
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103743359
   04928 Parathyroid hormone synthesis, secretion and action
    103743359
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103743359
  09154 Digestive system
   04972 Pancreatic secretion
    103743359
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103743359
  09158 Development and regeneration
   04360 Axon guidance
    103743359
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743359
   05206 MicroRNAs in cancer
    103743359
   05205 Proteoglycans in cancer
    103743359
   05203 Viral carcinogenesis
    103743359
  09162 Cancer: specific types
   05210 Colorectal cancer
    103743359
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103743359
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103743359
   05135 Yersinia infection
    103743359
   05133 Pertussis
    103743359
   05152 Tuberculosis
    103743359
   05100 Bacterial invasion of epithelial cells
    103743359
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103743359
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103743359
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103743359
   04031 GTP-binding proteins [BR:ngi04031]
    103743359
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103743359
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103743359
  Exosomal proteins of other body fluids (saliva and urine)
   103743359
  Exosomal proteins of colorectal cancer cells
   103743359
  Exosomal proteins of bladder cancer cells
   103743359
GTP-binding proteins [BR:ngi04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103743359
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA MMR_HSR1
Other DBs
NCBI-GeneID: 103743359
NCBI-ProteinID: XP_017656494
LinkDB
Position
Un
AA seq 193 aa
MATIRKKLVIVGDENSGKTCLLIIFSKDQFPEVYVPTVFENYVADIELDEKQVELALWDT
AGQEYYDRLRPLSYPDTDVILMCFSIGSPDSLDSIPRKWVPEAKHFCPSVPIILVGNKKD
LRNDSLARRALAKRKQEPVKSEQGRDMANKIGALVYMECSAKTEEGVREVFETAARAALQ
TRLRKTKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggccaccattaggaagaaactggtgattgttggtgatgaaaatagtggcaagacctgc
ttactcataatcttcagcaaggaccagttcccagaagtttatgtgcccaccgtgtttgag
aactatgtggcagatattgaactggatgaaaaacaggtcgagttggccttgtgggacaca
gctggacaagaatattacgatcgcctgaggcctctctcctatccagacactgatgttata
ttgatgtgtttctccattggcagccctgatagtttagacagcatcccaagaaaatgggtt
ccagaagccaagcacttctgtcccagtgtgcccatcatcctggttgggaacaagaaggat
cttcggaatgactctttagcaagacgggctttagctaagaggaagcaggagccggtaaaa
tctgagcaaggcagagatatggcgaacaagattggcgctttggtgtacatggagtgttca
gcaaagaccgaagaaggtgtgagggaggtttttgaaacagctgcaagagctgctttacaa
accagacttaggaagacaaaatctgggtgtcttgtgttgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750189
Entry
103750189         CDS       T03372                                 

Gene name
Rhoa
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04150  mTOR signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04350  TGF-beta signaling pathway
ngi04360  Axon guidance
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04530  Tight junction
ngi04611  Platelet activation
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04921  Oxytocin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04972  Pancreatic secretion
ngi05100  Bacterial invasion of epithelial cells
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103750189 (Rhoa)
   04015 Rap1 signaling pathway
    103750189 (Rhoa)
   04310 Wnt signaling pathway
    103750189 (Rhoa)
   04350 TGF-beta signaling pathway
    103750189 (Rhoa)
   04072 Phospholipase D signaling pathway
    103750189 (Rhoa)
   04071 Sphingolipid signaling pathway
    103750189 (Rhoa)
   04024 cAMP signaling pathway
    103750189 (Rhoa)
   04022 cGMP-PKG signaling pathway
    103750189 (Rhoa)
   04150 mTOR signaling pathway
    103750189 (Rhoa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103750189 (Rhoa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103750189 (Rhoa)
   04520 Adherens junction
    103750189 (Rhoa)
   04530 Tight junction
    103750189 (Rhoa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103750189 (Rhoa)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103750189 (Rhoa)
   04621 NOD-like receptor signaling pathway
    103750189 (Rhoa)
   04625 C-type lectin receptor signaling pathway
    103750189 (Rhoa)
   04660 T cell receptor signaling pathway
    103750189 (Rhoa)
   04670 Leukocyte transendothelial migration
    103750189 (Rhoa)
   04062 Chemokine signaling pathway
    103750189 (Rhoa)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103750189 (Rhoa)
   04928 Parathyroid hormone synthesis, secretion and action
    103750189 (Rhoa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103750189 (Rhoa)
  09154 Digestive system
   04972 Pancreatic secretion
    103750189 (Rhoa)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103750189 (Rhoa)
  09158 Development and regeneration
   04360 Axon guidance
    103750189 (Rhoa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750189 (Rhoa)
   05206 MicroRNAs in cancer
    103750189 (Rhoa)
   05205 Proteoglycans in cancer
    103750189 (Rhoa)
   05203 Viral carcinogenesis
    103750189 (Rhoa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103750189 (Rhoa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103750189 (Rhoa)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103750189 (Rhoa)
   05135 Yersinia infection
    103750189 (Rhoa)
   05133 Pertussis
    103750189 (Rhoa)
   05152 Tuberculosis
    103750189 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    103750189 (Rhoa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103750189 (Rhoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103750189 (Rhoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103750189 (Rhoa)
   04031 GTP-binding proteins [BR:ngi04031]
    103750189 (Rhoa)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103750189 (Rhoa)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103750189 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   103750189 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   103750189 (Rhoa)
  Exosomal proteins of bladder cancer cells
   103750189 (Rhoa)
GTP-binding proteins [BR:ngi04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103750189 (Rhoa)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 103750189
NCBI-ProteinID: XP_008851408
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtaattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccacggtgtttgag
aactatgtggcagatattgaagtggatggaaaacaggtagagttggctttatgggataca
gctggacaggaagattatgatcgcctgagacctctctcctatccggacactgatgttata
ctgatgtgtttctccatcgacagccctgatagtttagaaaacatccctgaaaaatggact
ccagaagtcaagcatttttgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcggaatgatgaacacacaagacgggagttagccaagatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcgaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system