KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743422
Entry
103743422         CDS       T03372                                 

Gene name
Upk3a
Definition
(RefSeq) uroplakin 3A
  KO
K19520  uroplakin-3a
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    103743422 (Upk3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103743422 (Upk3a)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103743422 (Upk3a)
SSDB
Motif
Pfam: PTP_tm Uroplakin_II
Other DBs
NCBI-GeneID: 103743422
NCBI-ProteinID: XP_008842922
LinkDB
Position
Un
AA seq 287 aa
MPLLWALLVLGCLQCGWTVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLNGTYE
VYLYAMVDSANSRNASVQDGAGIPLSSTFRQTQGGSTGPYKAAAFDLTPCSDLPSLDAVG
DVTQASEILNAYLVRVGSNRTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVQEQT
LWSDPIRTNQPIPYSTIDTWPGRRSGGMIVITSILGSLPFFLLVGFAGAIVLSFVDTGNS
DGETTHDSQITQEAVPKTLETFESSYTSVNRGPSLDRAEVFSSKLQD
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcctctgctctgggctctgctggtcctcggctgtctgcaatgtggatggactgtgaac
ctccagccccaactggccagcgtgacctttgccaccaacaaccccaccctcaccactgtg
gccttggagaagcctctgtgcatgtttgatagctcagagccgctcaacggcacctacgag
gtctacctttatgctatggttgattcagccaactccaggaatgcatctgtgcaggatggt
gcggggatccccttgagctccaccttcaggcaaactcagggcggaagtacaggcccctac
aaggctgcagccttcgacctgaccccttgcagtgacctgcccagcctggatgccgtcgga
gatgtgacccaggcttcagagatcctgaacgcatacctggtcagggtgggcagcaatcgg
acctgtctatgggaccccaacttccagggcctctgcaacccacccctgtcagcagccaca
gagtacaggttcaaatatgtcctggttaacatgtccacaggcttggtgcaagagcagacc
ctatggtcagatcccatccgtaccaaccagcccatcccctactcaaccatcgacacatgg
ccaggccgtcggagcggaggcatgatcgtcatcacctccatcctgggctccctgcccttc
ttcctgcttgtgggctttgcgggggccatcgtcctcagctttgtggatacaggaaactct
gatggggaaacaacgcatgattctcagatcacacaggaggctgtccccaagaccctggag
acctttgagtcttcctacacatctgtgaaccgggggccatccctggacagagctgaggtg
ttctctagcaagctccaggactaa

DBGET integrated database retrieval system