KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743486
Entry
103743486         CDS       T03372                                 

Gene name
Ep300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04024  cAMP signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04310  Wnt signaling pathway
ngi04330  Notch signaling pathway
ngi04350  TGF-beta signaling pathway
ngi04520  Adherens junction
ngi04630  JAK-STAT signaling pathway
ngi04720  Long-term potentiation
ngi04916  Melanogenesis
ngi04919  Thyroid hormone signaling pathway
ngi04922  Glucagon signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05016  Huntington disease
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05206  MicroRNAs in cancer
ngi05211  Renal cell carcinoma
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103743486 (Ep300)
   04330 Notch signaling pathway
    103743486 (Ep300)
   04350 TGF-beta signaling pathway
    103743486 (Ep300)
   04630 JAK-STAT signaling pathway
    103743486 (Ep300)
   04066 HIF-1 signaling pathway
    103743486 (Ep300)
   04068 FoxO signaling pathway
    103743486 (Ep300)
   04024 cAMP signaling pathway
    103743486 (Ep300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103743486 (Ep300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103743486 (Ep300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103743486 (Ep300)
   04935 Growth hormone synthesis, secretion and action
    103743486 (Ep300)
   04919 Thyroid hormone signaling pathway
    103743486 (Ep300)
   04916 Melanogenesis
    103743486 (Ep300)
  09156 Nervous system
   04720 Long-term potentiation
    103743486 (Ep300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743486 (Ep300)
   05206 MicroRNAs in cancer
    103743486 (Ep300)
   05203 Viral carcinogenesis
    103743486 (Ep300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    103743486 (Ep300)
   05215 Prostate cancer
    103743486 (Ep300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103743486 (Ep300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103743486 (Ep300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103743486 (Ep300)
   05161 Hepatitis B
    103743486 (Ep300)
   05164 Influenza A
    103743486 (Ep300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103743486 (Ep300)
   05165 Human papillomavirus infection
    103743486 (Ep300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103743486 (Ep300)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103743486 (Ep300)
   03029 Mitochondrial biogenesis [BR:ngi03029]
    103743486 (Ep300)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103743486 (Ep300)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    103743486 (Ep300)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103743486 (Ep300)
Mitochondrial biogenesis [BR:ngi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    103743486 (Ep300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 103743486
NCBI-ProteinID: XP_008843037
LinkDB
Position
Un
AA seq 2418 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLGLINS
MVKSPMAQTGLTSPNMGLATSGANQGPTQSTAGMMNSPVNQPAMGMNTGMSAGMNPGMLA
AGNGQGIMPNQVMNGSIGTGRGRPNMQYPNPGMGNAGNLLTEPLQQGSAQMGGQTGLRGP
QPLKMGMMSNPNPYGSPYTQNSGQQIGGSGLGLQIQTKTVLPNSLSPFAMDKKAVPGGGM
PSMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPPQPQVQAKNQQNQQSGQSPQGMRPMNNMSASPMGVNGGVGVQTPNLLSDTMLHSAINS
QNPMMSENASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
NAAGIVPVSMNPGPNMGQPQPGMTSNGPLPDPAMIRGSVPNQMMPRITPQPGLNQFGQMN
MPQPPIGPRQTSPLQHHGQLAQSGALNPPMGYGPRMQQPSSQNQFLSQTQFPPQGMNVTN
MPLAPSSGQAPVSQAQMSSSSCPVNSPIMTPGSQGSQIHCPPLSQQALHQNSPSPVPSRT
PTPHHTPPSIGTQQPPATAIPAPVPTPPAMPPGPQPQALHPPSRQTPTPPTTQLPPQVQP
SLPAAPSTDQSQQQPRSQQSTTASVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSS
TEVNSQTIPEKQPSQEVKMEVDHPETADTRPEEIHEAKTEDCKVEPTEVEERGTELKNDI
KEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMSTLEALYRQDPESLPFRQPVDPQL
LGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCS
KLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEK
CFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHE
IIWPAGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQSHPESGEVTV
RVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGS
DCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEG
DDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQANEDRLTSAKELPY
FEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSL
SRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDL
MDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHC
TVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLV
HACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPV
PFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQP
TTPQTPQPQPTAQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGP
PPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMTPMGMNPPPMARGPSGHLE
PGMGPTGMQQQPPWAQGGLPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPL
KPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPLP
GQPGIPQGQPGLQPPTMPGQQGVHSNPALQNMNPMQAGVQRAGLPQQQPPQQLQPPMGGM
SPQAQQMNMNHNTMPSQFRDLLRRHQIMQQQQQQQGAGPGIGPGMANHSQFQQPQGVGYP
AQQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNP
MSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSP
HHVSPQTSSPHPGLVAAQATNPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLS
TDNTDLNSNLSQSTLDIH
NT seq 7257 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcgtct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctgtttgacctggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacag
ctgtcagaattgctacggtctgggagttcccctaacctcaatatgggggttggtggccca
ggccaagtcatggccagccaggcccaacagaatagccctggattaggcttaataaatagc
atggtcaaaagcccaatggcccaaacaggcttgacttctcccaacatggggttggccact
agtggagcaaatcaaggtcctacacagtccacagcaggtatgatgaacagcccagtaaat
cagcctgccatgggaatgaacacagggatgagtgctggcatgaatcctggaatgttggct
gcaggcaatggacaagggataatgcccaatcaagtcatgaacggttcaattggaacaggc
cgagggcgaccgaatatgcagtacccaaacccaggcatgggaaatgctggcaatttattg
actgagccactacagcagggttctgcccagatgggaggacaaacaggattgagaggcccc
cagcctcttaagatgggaatgatgagcaatcccaatccttatggttcaccatatactcag
aattctggtcagcagattggaggcagtggccttggtctccaaattcagacaaagactgta
ctaccaaatagtttatctccatttgcaatggacaaaaaggcagtacctggtgggggaatg
cccagcatgggccaacagcctgccccacaggtccagcagccaggcttagtgactccagtt
gcccagggaatgggttctggagcacacacggctgatccagagaagcgcaagctcatccag
cagcagctggttctccttttgcatgctcataagtgccagcgcagggagcaggccaacggg
gaagtgaggcaatgcaaccttccccactgccgcaccatgaaaaacgttctaaaccacatg
acacactgccagtcaggcaagtcctgtcaagtggcacactgtgcatcttctcgccaaatc
atttcacactggaagaattgtacaaggcacgattgtcctgtgtgtcttcccctcaaaaat
gctggggataagcgaaatcaacagtcaattttgactggagcaccggttgggcttggaaac
cctagctctctaggggtgggtcaacagtctacccctagcctaagcactgttagtcagatt
gatcccagttctattgagcgagcctatgctgctcttggactaccctatcaagtaaaccag
atgccaccgcaaccccaagtacaagcaaagaaccaacaaaatcagcagtctgggcagtcg
ccccaaggcatgcggcccatgaacaacatgagtgctagccctatgggtgtaaatggaggt
gtaggagtgcagacaccgaatcttctttctgacacaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgctagtgtggcctccctgggccctatgcccacagca
gctcaaccatctagtactgggattcggaaacagtggcatgaagatattactcaggatctt
cgaaatcatcttgttcataaacttgtgcaagccatatttcccactccggatcctgctgct
ttaaaagacagacggatggaaaaccttgttgcctatgctcggaaagtagaaggggacatg
tatgagtctgcaaataatagagcggaatactaccacctcctagctgagaagatttataag
atccagaaagaactagaagagaaacgaaggactagactgcagaagcagaacatgcttcca
aatgctgccggcatagtgccagtttccatgaatccagggcctaacatgggacagccacaa
ccaggaatgacttctaatggccctctacctgacccagctatgatccgtggcagtgtgcca
aaccagatgatgcctcggattactccacaacctggtttgaatcagtttggccagatgaat
atgccccagccccctattggaccccggcaaacctctcctcttcagcaccatggacagttg
gctcagtctggagcgcttaatccgcctatgggctatggacctcgcatgcagcagccttcc
agccagaaccagttcctctcccagactcagttcccaccccagggaatgaatgtaacaaat
atgcctttggctccatccagtggtcaggcaccagtgtctcaagcacaaatgtccagttct
tcctgcccagtgaactctcctataatgactccagggtctcaggggagccaaattcactgt
ccgcccctgtctcaacaagctcttcatcagaattcaccctcacctgtacctagtcgtacc
cccactcctcatcatactcctccaagtatagggactcagcaaccaccagcaacagcaatc
ccagcccctgttcccacacctcctgccatgccacctgggccacagccccaggctctgcat
cctccctccagacagacacctacaccgccaaccacacagcttcctccccaagtgcagcct
tcacttcctgctgctccttcaactgaccagtcccagcaacagcctcgctcacagcagagt
acaacggcctccgttcctaccccaacggcaccactgctgcctccacagccttcaactccg
ctttctcagccagctgtaagcattgaaggccaggtgtcaaaccctccgtccacaagtagc
acagaagtgaattctcagaccatccctgagaaacagccttcgcaggaagtcaaaatggag
gtggatcaccccgaaacagcagacactcgacctgaggagattcacgaggctaaaactgaa
gattgtaaagtggagcctacagaagtagaagagaggggtactgagttaaaaaatgacata
aaagaggaagaagaccaaccaagtacttcagcgacccagtcttctccagccccaggacag
tcaaagaaaaagattttcaagccagaagaactacgacaagctctgatgtcaacattggag
gcactgtaccgtcaggacccagaatcccttccctttcgtcagcctgtcgaccctcagctt
ctaggaatacctgattactttgatattgtgaagagccccatggatctttctaccatcaag
aggaagttagacactggacagtatcaagagccctggcaatatgtagatgatatttggctc
atgtttaacaatgcctggttatataaccgcaaaacttcaagggtatataagtattgctcc
aagctctctgaggtgtttgaacaagaaattgaccctgtcatgcaaagccttggatactgc
tgtggcagaaagttggaattctctccacagacactctgttgctatggcaaacagttgtgt
acaatccctcgtgatgccacttactacagttaccagaacaggtatcatttctgtgagaag
tgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcccagcctcaa
actacaataaataaagaacagttttccaagagaaaaaatgacacactggatcctgaactg
tttgttgaatgtacagaatgtggaagaaaaatgcatcagatctgtgtccttcaccatgag
atcatctggccagctgggtttgtctgtgatggctgtttaaagaaaactgcacgaactagg
aaagaaaataagttctctgctaaaaggttgccatctaccagacttggcacctttctggag
aatcgtgtgaatgactttctgaggcgacagagtcaccctgaatcaggagaggtcactgtt
agggttgttcatgcttctgacaagactgtggaagtgaaacctggcatgaaagcaaggttt
gtagacagcggagagatggcagaatcctttccataccgaaccaaggccctctttgccttt
gaagagattgatggtgttgacttatgtttttttggcatgcatgttcaagagtacggctct
gactgccccccacccaaccagaggagagtatacatatcttacctcgacagtgttcatttc
ttccgtcctaaatgcttgaggactgcagtctatcatgaaattctaattgggtacttagag
tatgtcaagaaattaggatacacaacaggacatatttgggcatgtccaccaagtgaaggg
gatgactatatcttccattgccatcctcctgaccagaagatacccaagcccaagcgcctg
caggagtggtacaaaaagatgcttgacaaggctgtgtcagagcgtattgtccacgactac
aaggatattttaaaacaagctaatgaagatcgattaacaagcgcaaaggagttaccatac
tttgaaggtgatttctggccaaatgttttagaggagagcattaaggagcttgagcaggaa
gaagaagaaaggaagcgggaagagaacaccagcaatgaaagcactgatgtaacaaaggga
gacagcaaaaacgctaaaaagaagaataataaaaaaactagcaaaaacaagagcagcctg
agcaggggcaacaagaagaagcctggcatgcccaacgtgtccaatgacctgtctcagaag
ctgtacgccaccatggagaaacacaaagaggtcttctttgtaatccgcctcatcgctggc
cctgctgccaactccctgccccccatcgttgatcctgaccctcttattccctgtgatctg
atggatggtcgagacgcattcctcacccttgcaagggacaagcacctagaattctcttca
ctccgaagagcccagtggtctaccatgtgcatgctggtggagctgcacacacagagtcag
gaccgttttgtgtacacctgcaacgagtgcaagcaccacgtggagacacgctggcactgc
actgtctgcgaggattatgacctatgcatcacctgttataacactaaaaaccatgaccac
aaaatggagaaactaggtctcggcttagatgatgagagcaacaaccagcaggcagcagcc
acccagagcccaggagactctcgccgtctgagcatccagcgttgcatccagtctctggtc
catgcctgccagtgtcgcaatgccaactgctccctgccttcctgccagaagatgaagagg
gttgtacaacacaccaagggctgcaaaaggaaaaccaatggtggatgccccatctgcaag
cagctcattgcgctctgctgctaccatgccaagcactgccaggaaaacaagtgccccgtg
ccgttctgcctcaacatcaagcaaaagctccgacagcagcagctacagcaccggctccag
caggctcagatgctccgcaggaggatggccagcatgcagcggactggtgtggcagggcag
cagcaaggcctgccatccccaactcctgctactccaaccacaccaactggccagcagcca
accaccccacagacaccccagccccaacccactgctcaacctcagcctacccctcccaat
agcatgccaccctacttgcccaggactcaagctgctggccctgtgtcccagggtaaggca
gcaggccaggtgaccccaccaactccccctcagactgctcagcccccccttccagggccc
ccacctgcagcagtagaaatggcaatgcaaattcagagggcagcagagacgcagcgccag
atggcccatgtgcaaatttttcaaaggccaatccaacatcagatgccccaaatgactccc
atgacccctatgggcatgaacccacctcccatggccagaggtcccagtgggcacttggag
ccagggatggggcccacaggaatgcagcagcagccaccatgggcacaaggagggttgcct
cagccccagcaaatgcagtcagggatgccaaggccagccatgatgtctgtagcgcagcat
ggtcagcccttgaacatggctccacaaccaggattgggccaagtaggtgtgagcccactc
aaaccaggcactgtgtctcaacaagccttacaaaatcttttgcggactctcaggtctccc
agctctcccttacagcagcaacaggtgctcagtatccttcacgccaacccccagctgttg
gctgcgttcatcaaacagcgggctgccaagtatgccaactctaatccacagcctctccct
ggacagcctggcataccccagggacagccagggctgcagccgcccactatgcctggtcag
cagggcgtccactccaacccagcattgcagaacatgaatcctatgcaggcgggtgtccag
agagctggcctgccccagcagcagcccccacagcaactccagccacccatgggaggaatg
agcccccaagcacagcagatgaacatgaatcacaacacaatgccttcacagttccgagac
ctcctgagacgacatcagatcatgcagcagcagcagcagcagcagggagcagggccagga
atcgggcctgggatggctaaccacagtcagttccagcagccccaaggagttggctatccc
gcgcagcagcagcagcagcagcaacgaatgcaacatcacatgcagcagatgcagcaaggg
aatatgggacagatgggccagctcccccaggccttgggagcagaggcaggagccagtttg
caggcctaccaacagcgacttcttcagcaacagatggggtcgcctgctcagcccaaccct
atgagcccccaacagcatatgcttccaaatcaggcccagtctccacacctacaaggccag
cagatccctaactctctctccaatcaagtgcgctctccccagcctgtcccttctccacgg
ccacagtcccaacccccacattctagcccatccccaaggatgcagcctcagccttctcca
caccatgtttccccacagaccagttccccacatcctggactggtagctgcccaagccacc
aaccccatggaacaagggcattttgccagcccggaccagaattcaatgctttctcagctc
gctagcaatccaggcatggcaaacctccacggtgcaagcgccacggacctgggactgagc
accgataacacagacttgaattcaaacctctcacagagtacactagacatacactag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744441
Entry
103744441         CDS       T03372                                 

Gene name
Crebbp
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04024  cAMP signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04310  Wnt signaling pathway
ngi04330  Notch signaling pathway
ngi04350  TGF-beta signaling pathway
ngi04520  Adherens junction
ngi04630  JAK-STAT signaling pathway
ngi04720  Long-term potentiation
ngi04916  Melanogenesis
ngi04919  Thyroid hormone signaling pathway
ngi04922  Glucagon signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05016  Huntington disease
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05206  MicroRNAs in cancer
ngi05211  Renal cell carcinoma
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103744441 (Crebbp)
   04330 Notch signaling pathway
    103744441 (Crebbp)
   04350 TGF-beta signaling pathway
    103744441 (Crebbp)
   04630 JAK-STAT signaling pathway
    103744441 (Crebbp)
   04066 HIF-1 signaling pathway
    103744441 (Crebbp)
   04068 FoxO signaling pathway
    103744441 (Crebbp)
   04024 cAMP signaling pathway
    103744441 (Crebbp)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103744441 (Crebbp)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103744441 (Crebbp)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103744441 (Crebbp)
   04935 Growth hormone synthesis, secretion and action
    103744441 (Crebbp)
   04919 Thyroid hormone signaling pathway
    103744441 (Crebbp)
   04916 Melanogenesis
    103744441 (Crebbp)
  09156 Nervous system
   04720 Long-term potentiation
    103744441 (Crebbp)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103744441 (Crebbp)
   05206 MicroRNAs in cancer
    103744441 (Crebbp)
   05203 Viral carcinogenesis
    103744441 (Crebbp)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    103744441 (Crebbp)
   05215 Prostate cancer
    103744441 (Crebbp)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103744441 (Crebbp)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103744441 (Crebbp)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103744441 (Crebbp)
   05161 Hepatitis B
    103744441 (Crebbp)
   05164 Influenza A
    103744441 (Crebbp)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103744441 (Crebbp)
   05165 Human papillomavirus infection
    103744441 (Crebbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103744441 (Crebbp)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103744441 (Crebbp)
   03029 Mitochondrial biogenesis [BR:ngi03029]
    103744441 (Crebbp)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103744441 (Crebbp)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    103744441 (Crebbp)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103744441 (Crebbp)
Mitochondrial biogenesis [BR:ngi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    103744441 (Crebbp)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 103744441
NCBI-ProteinID: XP_008844419
LinkDB
Position
Un
AA seq 2444 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGELSLLNSGNLVP
DAASKHKQLSELLRGGSGSTINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKS
PLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNATF
NQAHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGTAGRGRGAGIPYPAPAMQGATSSVLAE
TLTQVSPQMASHAGLSTAQAGGMTKMGMTGNTSPFAQPFSQTGGQQMGATGVNPQLSSKQ
SMVNSLPAFPTDIKNTSVTNVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSM
QRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNPLGNNPMNIPAGGITTDQQ
PPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPPSQSVRPPNGPLPLPVNRMQVSQGL
NSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMSTHAN
NLMAQAPTQNQFLPQSQFSSSSGAMSVNSVGMGQPAAQTALSQGQVPGGALPNPLNMLAP
QASQLPCPQVTQSPLHPTPPPASTAAGMPSLQHPTPPGMTPPQPAAPTQPSTPVSSGQTP
TPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGT
PLSQAAASIDNRVPTPSSVASAETSSQQPGPDIPVLEMKAEVQTDDAEPDPGESKGEPRS
EMMQEDLQGSSQVKEETDTAEQKSEPMEVEEKKPEVKVEAKEEEENSANGTASQSTSPSQ
PRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIK
RKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYC
CGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQ
TTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPR
KENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRF
VDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHF
FRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRL
QEWYKKMLDKAFAERIIHDYKDILKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQE
EEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQ
KLYATMEKHKEVFFVIHLHAGPVIHTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFS
SLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHT
HKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMK
RVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRL
QQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPA
GFPSVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINN
GMPPGRTGMGTPGSQMAPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPV
MSMPAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAA
FIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPGLQNLNAMQAGVPRPGVPPQQQ
AMGGLTPQGQALNIMNPGHNPNMANMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQQQQS
SASMAGGMAGHGQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPG
LGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATS
LSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQG
HLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7335 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagttctccc
ggcttctcggcaaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggagaattaagccttttaaacagtgggaaccttgttcca
gatgctgcttccaaacataaacaactttcggagcttcttagaggaggcagcggctctacc
ataaatccaggaataggaaatgtgagcgccagtagccctgtgcagcagggccttggtggc
caggctcaggggcagccgaacagtacaaacatggccagcctgggtgccatgggcaagagt
cctctgaaccagggagattcatcagcccctagcctacccaaacaggcagccagcacctct
gggcccacacctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggactt
gtgaccagtagccctgccacgtcacagactggacctgggatctgcatgaatgctactttc
aaccaggcccacccaggcctcctcaatagtaactctggccatagcttaatgaatcaggcc
cagcaagggcaggctcaagtcatgaatggatctcttgggactgccggaagaggaagagga
gctggaataccataccctgctccagccatgcagggggccacaagcagtgtgctggctgag
accttgacacaggtttccccacaaatggctagccatgctggactgagcacagcacaggca
ggaggcatgaccaagatgggaatgactggtaatacaagtccatttgcacaaccctttagt
caaactggagggcagcaaatgggagccactggagtgaacccccagttatctagcaaacag
agcatggtcaatagtttgcctgcttttcctacagacatcaagaatacttcagtcaccaat
gtgccaaatatgtcccagttgcaaacatcagtgggaattgtacccacacaggcaattgca
acaggccccactgcagatcccgagaaacgcaaactgatacagcagcagctggttctactg
cttcatgctcataaatgtcagagacgagaacaagcaaacggagaggttcgggcctgctca
ctcccacattgtcgaaccatgaaaaatgttttgaatcacatgacgcattgccaggctggg
aaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcttggggtctccagctagtggaattcaaaacacaattggttctgttggt
gcaggacaacagaatgccacttctttaagtaacccaaaccccatagaccccagttccatg
cagcgggcctatgctgctctcggacttccctacatgaaccagccccagacgcagctacag
cctcaggttcctggccagcaaccagcacagcctccagcccaccagcagatgaggactctc
aatccccttgggaataacccaatgaacattccagcagggggaataacaacagatcagcag
ccacccaacttgatttcagaatcagctcttccaacttccttaggggctaccaatccactg
atgaatgatggctccaactctggtaacattggaagcctcagcacgatacctacagcagca
cctccttccagcactggtgttcggaaaggctggcatgagcatgtcactcaggacctgcgg
agccatttagtccataaacttgtccaagccatcttcccaacccccgaccccgcagctctg
aaagatcgccgcatggagaacctagtcgcctatgctaagaaagtggagggggacatgtat
gagtctgctaacagcagggatgaatactaccatttattagcagagaaaatctataaaata
caaaaagaactcgaagaaaaacggaggtcacgtttacataagcagggcatcctgggtaac
cagccagctttaccagctcctggggctcagccccctgtgatcccaccaagccagtctgtg
agaccgccaaatggacccctgcccctgccagtgaatcgcatgcaggtttctcaagggttg
aattcatttaacccaatgtccttgggaaatgtccagttaccacaagcacccatgggacca
cgtgcagcctcccccatgaaccactctgttcagatgaacagcatggcctcagttccaggc
atggccatttctccttcccggatgcctcagcccccgaacatgatgagtacccatgccaac
aacctgatggcccaggcacccactcagaaccagtttctgccacagagccagttctcatca
tccagtggggcaatgagtgtaaatagtgtgggcatggggcagccagcagcccagacagcc
ttgtcacagggccaggtgcctggtggtgctcttcctaaccctttgaacatgctggcaccc
caggccagccagctgccttgcccacaagtgacacagtcaccattgcaccctactccacct
cctgcttccacagctgctggcatgccctctctccaacacccaacaccacctgggatgaca
cctccccagccagcagctcccacgcagccatccactcctgtatcatctgggcagactccc
accccaactcctggctcagtgcccagtgctgcccaaacacagagcacccctacagtccag
gcagcagctcaggcccaggtgaccccacagcctcaaacaccagtgcagcccccatctgtg
gctaccccgcagtcatcacaacagcagccaacgcctgtgcacacccagcctcctggcaca
ccgctttctcaggcagcagccagcattgataacagggtccccactccctcctctgtggcc
agtgctgaaaccagctcccagcagccaggacctgacatacctgtgctggaaatgaaggca
gaggtccaaacggatgatgctgagcctgatcctggtgaatccaagggggaacctcggtct
gagatgatgcaagaggatttgcaaggatcttcccaggttaaagaagaaacagatacagca
gagcagaagtcagagccaatggaagtggaagaaaagaaacccgaagtaaaagtggaagct
aaagaagaagaagagaatagtgctaatggcacagcctctcagtcaacatccccttcacag
ccacgaaaaaagatctttaaacctgaggagctacgccaggcacttatgccaaccctagaa
gcactctatcgacaggatccagagtctttaccttttcgacaacctgtagatccccagctt
ctaggaattccagattattttgacattgtgaagaatcccatggacctttctactatcaag
cggaagctggatacagggcagtatcaagaaccctggcagtatgtggatgacgtctggctt
atgttcaacaatgcttggctgtataatcgtaagacgtcccgggtctataaattttgcagt
aaactggcagaggtctttgagcaagaaattgatcctgtcatgcagtctcttggatattgc
tgtggtcgcaagtatgagttttccccacagactttgtgctgctatgggaagcagctgtgt
acaattcctcgtgatgctgcctactacagctatcagaataggtatcatttctgtgagaag
tgtttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcccaacctcag
acgacaatttccaaggatcagtttgaaaagaagaaaaatgataccttagatcctgaacct
ttcgttgattgcaaagagtgtggccggaaaatgcatcagatttgcgttctgcactatgac
atcatttggccttcgggttttgtgtgtgacaactgcttaaagaaaactggcagacctcgt
aaagaaaacaaattcagtgctaagagactgcagaccacacgattgggaaaccacttggaa
gaccgagtgaacaagtttttacggcgccagaatcaccctgaagctggggaggtttttgtc
agagtggtggcgagctcagacaagactgtggaagtcaagcctgggatgaagtcaaggttt
gtggactcaggagaaatgtctgaatctttcccatatcgaaccaaagcgctctttgccttc
gaggagatcgatggagtagatgtgtgcttttttgggatgcatgtgcaagaatatggctct
gattgcccccctccaaacacaaggcgtgtgtacatatcttatctggacagtattcatttc
ttccggccccgctgcctccggacagctgtttaccacgagatcctcattggatacctagag
tatgtgaagaaattggggtatgtgacagggcacatctgggcctgccccccaagtgaagga
gatgactacatcttccattgccacccccctgatcagaaaatccccaaaccaaaacgacta
caagagtggtacaagaagatgttggataaagcatttgcagagcgaatcattcatgactat
aaggatatcttaaaacaagcaaatgaagacaggctcacaagtgccaaggagttgccttat
tttgaaggagatttttggcccaatgtgttggaagaaagcattaaggagctagaacaagaa
gaagaggagaggaaaaaagaagagagcactgcagctagtgagactcctgagggtagtcag
ggtgacagcaagaatgccaagaaaaagaacaacaagaagaccaacaagaataaaagcagc
attagccgcgccaacaagaaaaagcctagcatgcccaatgtgtctaatgacctgtcccag
aagctctatgccaccatggagaaacacaaagaggttttctttgtgattcacctgcatgct
gggcctgtcatccataccctgccccccatcgtggaccctgaccccctgctcagctgtgac
ctcatggatgggcgtgatgccttcctcaccctggctagagacaagcactgggagttctct
tccttacgccgatccaagtggtccacactgtgcatgctggtagagctacacacgcagggc
caggatcgcttcgtctatacctgcaacgagtgcaagcaccacgtggagacacgctggcac
tgcactgtgtgtgaggactacgacctttgcatcaattgctacaatacaaagagccacacc
cacaagatggtgaagtggggactaggcctggacgacgagggcagcagtcagggtgagcca
cagtccaagagcccccaggagtcccggcgtctgagtatccaacgctgcatccagtccctg
gtacatgcctgccagtgtcgcaatgccaactgctcgctcccatcttgccagaagatgaag
cgggttgtgcagcacaccaagggctgcaagcgcaagaccaatggaggctgcccagtgtgc
aagcagctcatcgctctttgctgctaccacgccaaacactgccaagaaaacaaatgccct
gtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcatcgcctg
cagcaggctcagctcatgcgccgtcgaatggccaccatgaacacccgcaatgtgcctcag
cagagtttgccttctcctacctcagcaccacctgggacccccacgcagcagcccagcacg
ccccagacaccacagccccctgcccagccccagccttcacccgtgagcatgtcaccagct
ggcttccctagtgtggcccggactcagcccccgacaatagtgtctgctgggaagcctacc
aaccaggtgccagcgcctccaccccccgcccaacccccacctgcagcagtggaagcagcc
cggcaaattgaacgtgaggcccagcagcagcagcacctctaccgagcaaacatcaacaat
ggcatgcccccagggcgcacaggtatggggaccccagggagccaaatggcccccgtgggc
ctgaatgtaccccggcccaaccaagtcagtgggcctgtcatgtccagcatgccacctgga
caatggcagcaggcacccatccctcagcagcagccaatgccaggcatgcctaggcctgtg
atgtctatgccggcccaggcagctgtggctgggccacggatgcccagtgtgcagccacca
aggagcatctcacccagtgccctgcaagacctgctgcggaccctgaagtcacccagctcc
cctcagcagcagcagcaggtgctgaacatcctcaagtcaaacccacagctaatggcagct
ttcatcaaacagcgtacagccaagtatgtggccaatcagcctggcatgcaaccccagccc
ggactccagtcccagcctggcatgcagccccagcctggcatgcaccagcagcccggcctg
cagaacctgaatgcaatgcaagccggtgtgccacggcctggtgtacctccacagcagcag
gcgatgggaggcctgaccccccaaggacaggctctgaacatcatgaacccgggacacaac
cccaatatggcgaacatgaatccacagtaccgagagatggtgaggaggcagctgctacag
caccaacagcagcagcagcaacagcagcagcagcagcagcagcagcaacagcagcaaagc
agtgccagcatggccgggggcatggcaggacacggccagttccagcagccacaaggaccc
ggaggctatgctccagccatgcagcagcagcgcatgcagcaacacctccctatccagggc
agctccatgggccagatggccgctcccatgggacagcttggccagatggggcagcctggg
ctgggggcagacagcacccccaacatccagcaggccctacagcagcggattctgcagcag
cagcagatgaagcaacagattgggtccccaggccagccgaaccccatgagcccccagcaa
cacatgctctcaggacagccacaggcctcacatctccctggccagcagatcgccacatcc
cttagtaaccaggtgcggtctccagcccctgtccagtctccacgaccccagtcccagcct
ccacattccagcccgtcaccacggatacagccccagccttcaccacaccatgtctcgccc
cagactggttccccccaccctggacttgcagtcaccatggccagctccatggatcaggga
cacttggggaacccagaacagagtgcaatgcttccccagctgaatacccccagcaggagc
gcactgtccagtgaactgtcgctggtcggtgacaccacgggagacacactagaaaagttt
gtggagggtttgtag

DBGET integrated database retrieval system