KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743639
Entry
103743639         CDS       T03372                                 

Gene name
Bax
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04071  Sphingolipid signaling pathway
ngi04115  p53 signaling pathway
ngi04141  Protein processing in endoplasmic reticulum
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04215  Apoptosis - multiple species
ngi04217  Necroptosis
ngi04722  Neurotrophin signaling pathway
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05012  Parkinson disease
ngi05014  Amyotrophic lateral sclerosis
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103743639 (Bax)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    103743639 (Bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103743639 (Bax)
   04215 Apoptosis - multiple species
    103743639 (Bax)
   04217 Necroptosis
    103743639 (Bax)
   04115 p53 signaling pathway
    103743639 (Bax)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103743639 (Bax)
  09149 Aging
   04211 Longevity regulating pathway
    103743639 (Bax)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743639 (Bax)
   05202 Transcriptional misregulation in cancer
    103743639 (Bax)
   05203 Viral carcinogenesis
    103743639 (Bax)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103743639 (Bax)
   05212 Pancreatic cancer
    103743639 (Bax)
   05225 Hepatocellular carcinoma
    103743639 (Bax)
   05226 Gastric cancer
    103743639 (Bax)
   05214 Glioma
    103743639 (Bax)
   05216 Thyroid cancer
    103743639 (Bax)
   05220 Chronic myeloid leukemia
    103743639 (Bax)
   05217 Basal cell carcinoma
    103743639 (Bax)
   05218 Melanoma
    103743639 (Bax)
   05213 Endometrial cancer
    103743639 (Bax)
   05224 Breast cancer
    103743639 (Bax)
   05222 Small cell lung cancer
    103743639 (Bax)
   05223 Non-small cell lung cancer
    103743639 (Bax)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103743639 (Bax)
   05014 Amyotrophic lateral sclerosis
    103743639 (Bax)
   05016 Huntington disease
    103743639 (Bax)
   05020 Prion disease
    103743639 (Bax)
   05022 Pathways of neurodegeneration - multiple diseases
    103743639 (Bax)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103743639 (Bax)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103743639 (Bax)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103743639 (Bax)
   05152 Tuberculosis
    103743639 (Bax)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103743639 (Bax)
   05170 Human immunodeficiency virus 1 infection
    103743639 (Bax)
   05161 Hepatitis B
    103743639 (Bax)
   05160 Hepatitis C
    103743639 (Bax)
   05164 Influenza A
    103743639 (Bax)
   05162 Measles
    103743639 (Bax)
   05168 Herpes simplex virus 1 infection
    103743639 (Bax)
   05163 Human cytomegalovirus infection
    103743639 (Bax)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103743639 (Bax)
   05169 Epstein-Barr virus infection
    103743639 (Bax)
   05165 Human papillomavirus infection
    103743639 (Bax)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103743639 (Bax)
   01524 Platinum drug resistance
    103743639 (Bax)
   01522 Endocrine resistance
    103743639 (Bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ngi03029]
    103743639 (Bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ngi02000]
    103743639 (Bax)
Mitochondrial biogenesis [BR:ngi03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    103743639 (Bax)
Transporters [BR:ngi02000]
 Other transporters
  Pores ion channels [TC:1]
   103743639 (Bax)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 103743639
NCBI-ProteinID: XP_008843240
LinkDB
Position
Un
AA seq 193 aa
MMDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQAPQDASTKKL
SECLKRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASK
LVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAG
VLTASLTIWKNMG
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatggacgggtcgggggagcagctcggaggcggtgggcccaccagctctgagcagatc
atgaagactggggcctttttgcttcagggtttcatccaggatcgagctgggaggatggca
ggggagacccctgagctgaccctggagcaggcgccacaggatgcatccaccaagaagctg
agcgagtgtctcaagcggatcggagatgagctggacagcaacatggagctgcagaggatg
attgctgatgtggacactgactcccccagagaggtcttcttcagagtggcagctgatatg
tttgctgatggcaacttcaactggggccgggttgtcgcccttttctactttgccagtaaa
ctggtgctcaaggccctgtgcaccaaagtgcccgagctaatcagaaccatcatgggttgg
acgctggacttcctccgagagcggctgcttgtctggatccaagaccagggtggctgggat
ggcctcctctcctacttcgggacccctacgtggcagacggtgaccatcttcgtggctgga
gtcctcactgcctcactcaccatctggaagaatatgggctga

DBGET integrated database retrieval system