KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743640Help
Entry
103743640         CDS       T03372                                 

Gene name
Gys1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00500  Starch and sucrose metabolism
ngi01100  Metabolic pathways
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04910  Insulin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103743640 (Gys1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103743640 (Gys1)
   04152 AMPK signaling pathway
    103743640 (Gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103743640 (Gys1)
   04922 Glucagon signaling pathway
    103743640 (Gys1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    103743640 (Gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ngi01003]
    103743640 (Gys1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103743640 (Gys1)
Glycosyltransferases [BR:ngi01003]
 Polysaccharide
  Storage polysaccharide
   103743640 (Gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103743640
NCBI-ProteinID: XP_008843241
LinkDB All DBs
Position
Un
AA seq 738 aa AA seqDB search
MPLTRSLSMSSLPGLEDWEDEFDLQNTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLIGPYTEQGVRTQVELLEPPIPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVTHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNIKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANAVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHKADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPLVEDGERYDEEAEAAKDRRNIRAPEWPRRASCASSTGGSRRSNSVDTGPSSSI
STPSEPLSPASSLGEERN
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgacccgcagtctctctatgtcctcgcttccagggctggaggactgggaggat
gagttcgacctgcagaacactgtacttttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacactgtgctgcagacaaaggcgaaggtgacgggagatgaatggggcgac
aactactatctgattggcccatacacagagcagggtgtgaggacccaggtagagctgctg
gaacccccaatccccgaactcaagaggactctggattccatgaacagcaagggctgcaag
gtgtatttcggacgctggctgattgaaggggggcccctggtggtgctcctggatgtgggg
gcctctgcctgggccctggagcgctggaagggcgagctctgggatacctgcaacatcggg
gtgccctggtatgaccgtgaggccaatgatgcagtcctgtttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacatgtggttacccacttccac
gaatggttggcaggcattgggctgtgtctgtgccgtgcacggcgcctgcctgtggcaacc
atcttcaccacccatgccacattgctgggccgatacctgtgtgctggtgctgtggacttc
tacaacaacctggagaatttcaacgtggacaaggaggcaggtgagaggcagatctaccat
cgctactgcatggagcgtgcagcagcgcactgtgcccacgtgttcactaccgtgtcccag
atcacagccatagaggctcagcacctcctcaagaggaaaccagatatcgtgacccccaat
ggcctgaacataaagaagttctccgccatgcatgagttccagaacctccatgctcagagc
aaagctcggatccaagagtttgtgaggggccatttttacgggcacctggactttaactta
gataagaccttgtatttctttatcgccggccgctacgaattctccaacaaaggagctgat
gtgttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagtgagcag
acagttgtagccttcttcatcatgccggctcgaaccaacaatttcaatgtggaaaccctg
aagggtcaagctgtgcgcaagcagctctgggacacagccaacgcagtcaaggagaagttt
gggaggaagctttatgaatccttactggtgggtagcctcccagacatgaacaagatgctg
gacaaggaagatttcactatgatgaagagagcaatctttgccacacagcgtcaatcattc
ccccctgtgtgcacccacaatatgttggatgactcttcagaccccatcctgaccaccatc
cgccgaattggcctttttaacagtagtgctgaccgggtgaaggtgatttttcacccagag
ttcctctcttccacaagccctctgctccccgtggactatgaggagtttgtccgtggctgt
catcttggggtcttcccctcctattatgagccctgggggtatactccagcggagtgcacg
gtcatgggcatccccagcatctccaccaacctttccggctttggttgcttcatggaggag
cacatcgcagacccctcagcttatggcatctacattctggaccggaggttccgcagcctt
gacgattcctgctcgcagctcacctccttcctgtacagcttctgccagcagagccggagg
cagcgcatcatccagcggaaccgcaccgagcgcctgtcggacctgctggattggaagtac
ctaggccggtactatatgtctgcccgccacatggctctggccaaggcctttccagatcat
ttcacctacgaacctcacaaggcagatgcggcccaggggtaccgctacccacggccagcc
tccgtgccaccatcaccctccttgtctcgacactcaagtccacaccagagtgaggatgag
gaagagccccgagatggacccctggtggaagacggtgagcgttacgatgaggaggcagag
gctgccaaggaccgccgcaacatccgggcacccgagtggccacgtcgggcctcctgtgcc
tcgtccaccggcggtagcaggcgaagcaactcggtggacactggcccctccagctcgatc
agcacccccagtgagcccctcagccctgccagttccctgggcgaggaacgaaactaa

DBGET integrated database retrieval system