KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743825
Entry
103743825         CDS       T03372                                 

Gene name
Erbb2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04530  Tight junction
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05219  Bladder cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103743825 (Erbb2)
   04012 ErbB signaling pathway
    103743825 (Erbb2)
   04066 HIF-1 signaling pathway
    103743825 (Erbb2)
   04020 Calcium signaling pathway
    103743825 (Erbb2)
   04151 PI3K-Akt signaling pathway
    103743825 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103743825 (Erbb2)
   04520 Adherens junction
    103743825 (Erbb2)
   04530 Tight junction
    103743825 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743825 (Erbb2)
   05206 MicroRNAs in cancer
    103743825 (Erbb2)
   05205 Proteoglycans in cancer
    103743825 (Erbb2)
   05230 Central carbon metabolism in cancer
    103743825 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103743825 (Erbb2)
   05226 Gastric cancer
    103743825 (Erbb2)
   05219 Bladder cancer
    103743825 (Erbb2)
   05215 Prostate cancer
    103743825 (Erbb2)
   05213 Endometrial cancer
    103743825 (Erbb2)
   05224 Breast cancer
    103743825 (Erbb2)
   05223 Non-small cell lung cancer
    103743825 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103743825 (Erbb2)
   01524 Platinum drug resistance
    103743825 (Erbb2)
   01522 Endocrine resistance
    103743825 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103743825 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103743825 (Erbb2)
   04090 CD molecules [BR:ngi04090]
    103743825 (Erbb2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103743825 (Erbb2)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103743825 (Erbb2)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   103743825 (Erbb2)
CD molecules [BR:ngi04090]
 Proteins
  103743825 (Erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH RIFIN Kinase-like
Other DBs
NCBI-GeneID: 103743825
NCBI-ProteinID: XP_008843541
LinkDB
Position
Un
AA seq 1251 aa
MELAAWCRWGLVLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRYLYQGCQVVQGNL
ELTYLPANTSLSFLQDIQEVQGYLLIAHNHVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLDNVTPAPGGLRELQLRSLTEILKGGVLIRGNPQLCFQDRILWKDIFRKSNQLAPMDI
DSNSSRACPPCAPACKDNYCWGESSEDCQILTGIICTSGCARCKGRLPTDCCHEQCAAGC
TGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTTCPYNYL
STEVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLRAVRAVTSANIQEF
AGCKKIFGSLAFLQESFDGDPASNTAPLQPEQLRVFETLEEITGYLYISAWPDSLPDLSV
FQNLRVIRGRILHDGAYSLTLQGLGIRWLGLRSLQELGSGLALIHRNTHLCFIHTVPWDQ
LFRNPHQALLHSGNRPEEACAQEGLACYPLCAQGHCWGPGPTQCVNCSQFLRGQECVEEC
RVLQGLPREYVNDRHCLPCHPECQPQNGSKTCFGSEADQCVACAHYKDPPFCVARCPSGV
KPDLSYMPIWKFPDEEGTCQPCPINCTHSCIDLDDRGCPAEQRASPVTSSIVAVVSILLF
LVMVVVPGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELRKVK
VLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSR
LLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVRLVHR
DLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSD
VWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSE
CRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYL
VPQQGFFCPDPAPGTGSTAHRRHRSSSARSGGGELTLGLEPSEEEPPRSPLAPSEGAGSD
VFDGDLGMGAAKGLQSLPQHDLSPLQRYSEDPTVPLPLETDGYVAPLTCSPQPEYVNQPE
VRPELVSPLEGPLPLIRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPRGGTT
PQPYTPPAFSPAFDNLYYWDQDPSERGSPPSTFEETPTAENPEYLGLDVPV
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcgtcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgtacgggcacagacatgaagttgcggctccctgcgagtcctgag
actcacctggacatgctccgctacctctaccagggctgtcaggtggtgcagggtaacctg
gaacttacctacctgccagccaataccagcctctccttcctgcaggacatccaggaggtt
cagggatacctgctcatcgctcacaaccacgtgaggcaggtcccactgcagaggctgcgc
attgtgcgagggacccagctctttgaggacaactatgccctggccgtattagacaacgga
gaccctctggacaatgtcacccctgccccaggagggttgcgggagctgcagcttcgaagc
ctcacagagatcctgaagggaggagttttgatccgtgggaaccctcagctctgcttccag
gacagaattttgtggaaggacatcttccggaagagcaaccaactggctccaatggatata
gacagcaatagctcacgagcctgcccgccctgtgccccagcctgtaaagacaattattgt
tggggggagagttccgaggactgtcaaatcttgactggcatcatctgtaccagtggttgt
gcccgttgcaagggccggctgcccacggactgctgccatgagcagtgtgctgctggctgc
acgggtcccaagcattctgactgcctggcctgcctccacttcaatcatagtggcatctgt
gagctgcactgcccagcccttgtcacctataacacggacactttcgagtccatgcccaac
cctgagggccgttacacctttggtgccagctgtgtgaccacctgtccctacaactacctg
tctacggaggtgggatcctgcaccctggtctgtcccctgaacaaccaagaggtgacagct
gaggatggaacacagcggtgtgaaaaatgcagcaagccctgtgctcgagtgtgctatggt
ctgggcatggaacacctgcgggcagtgagggccgtgacaagtgccaatatccaggagttt
gcgggctgcaagaagatctttgggagcctggcatttttgcaggaaagctttgatggggac
cctgcctcgaacactgctcccctgcagcctgagcagctccgcgtgtttgagacgctggag
gagatcacaggttacctgtacatctcagcgtggccagacagccttcctgacctcagtgtc
ttccagaaccttcgagtcattcggggacgcattctacatgatggtgcctattcgctaacc
ctgcaaggtctgggcatccgttggttgggactgcgctcgcttcaggagctgggcagtggg
ctggccctcattcaccgcaacacccacctctgcttcatacacacggtgccttgggaccag
ctcttccggaatccccaccaggccctactccatagtggcaaccggccagaggaggcatgt
gctcaagagggcctagcctgctacccactgtgtgcccaggggcactgctggggcccaggg
cccacccagtgcgtcaactgcagccaattccttcggggccaagagtgtgtggaggaatgc
cgagtgctgcaggggctccctagggagtatgtgaatgacaggcactgtctgccatgccac
cccgagtgtcagccccagaatggctcaaagacctgctttggatcggaggctgaccagtgt
gtggcctgtgcccactataaggatccacccttctgtgtggctcgctgccccagtggtgta
aaaccagatctctcctacatgcccatctggaagttcccggatgaggagggcacatgccag
ccatgccccatcaactgcacccactcctgcattgacctggatgacaggggctgcccagca
gaacagagagccagcccagtgacatccagcatcgttgctgtggtgagcatcctgttgttc
ctggtcatggtggtggtccctgggatcctaatcaagcgaaggcgccagaaaatccgaaag
tacacaatgcgcaggctgctgcaggaaactgagctggtggagcccctaacacccagcgga
gccatgcccaaccaggctcagatgcggatcttgaaagagacagagctcaggaaggtgaag
gtccttggatctggagctttcggcactgtctacaagggcatctggatcccggatggggag
aatgtaaaaatccctgtggccatcaaggtgttgagggaaaacacatcccccaaagctaac
aaagaaatcttggacgaagcatatgtgatggctggtgtgggttctccatatgtgtcccgc
ctcctgggcatctgcctgacatccacagtgcagctggtaacacagcttatgccctatggc
tgcctcctggaccatgtccgagaacaccgagggcgcttgggctcccaggacctgctcaat
tggtgtgttcagattgccaaggggatgagctacctggaggatgtgcggcttgtgcacagg
gacctggctgcccggaatgtactggtcaagagtcccaaccatgtcaagattacagacttt
gggctggctcggttactggacattgatgagacagagtaccacgcagatgggggcaaggtg
cccatcaaatggatggcgttggagtccattctccgccggcggttcactcatcagagtgat
gtgtggagctatggtgtgactgtgtgggagttgatgacttttggagccaaaccttatgat
ggcatcccagcccgggagatccctgacttgctggagaagggggagcggctgcctcagcct
ccaatctgcaccatagatgtctacatgatcatggtcaaatgttggatgattgattctgaa
tgtcggccgagattccgggagttggtgtcagaattctcccgcatggccagggacccccag
cgctttgtggtcatccagaatgaagacttgggcccagccagccccttagacagtaccttc
tatcgctcactgttggaggatgatgacatgggtgacctggtagatgctgaggagtatctg
gtacctcagcagggatttttctgccctgaccccgccccaggcaccgggagcactgcccac
cgtaggcaccgaagctcatccgccaggagtggaggtggtgagctgacactggggctggag
ccctctgaagaggagccccccaggtctccactagccccctcagaaggggctggctccgat
gtgtttgatggtgacctaggaatgggggcagccaaggggctgcagagcctcccccaacac
gacctcagccctctacagcggtacagtgaggaccccacagtacctctgcccctcgagact
gatggctatgttgcccctctgacctgcagcccccagcccgaatatgtgaaccagccagag
gttcgaccagagcttgtctcacccttggagggtcctctgcctctcatccggcctgctggt
gctactctggaaaggcccaagactctctctcctgggaagaatggggttgttaaagacgtt
tttgcttttgggggtgctgtggagaatcctgagtacttggcacccagaggaggcactacc
cctcagccctacactcctcctgcctttagcccagcctttgacaatctctattactgggac
caggacccatcagagcggggatctccaccaagcaccttcgaagagactcctacagcagag
aaccccgagtacctgggcctggacgtgccagtgtga

DBGET integrated database retrieval system