KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743920
Entry
103743920         CDS       T03372                                 

Gene name
Myc
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04110  Cell cycle
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04350  TGF-beta signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05132  Salmonella infection
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05216  Thyroid cancer
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103743920 (Myc)
   04012 ErbB signaling pathway
    103743920 (Myc)
   04310 Wnt signaling pathway
    103743920 (Myc)
   04350 TGF-beta signaling pathway
    103743920 (Myc)
   04390 Hippo signaling pathway
    103743920 (Myc)
   04630 JAK-STAT signaling pathway
    103743920 (Myc)
   04151 PI3K-Akt signaling pathway
    103743920 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103743920 (Myc)
   04218 Cellular senescence
    103743920 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103743920 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103743920 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743920 (Myc)
   05202 Transcriptional misregulation in cancer
    103743920 (Myc)
   05206 MicroRNAs in cancer
    103743920 (Myc)
   05205 Proteoglycans in cancer
    103743920 (Myc)
   05230 Central carbon metabolism in cancer
    103743920 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103743920 (Myc)
   05225 Hepatocellular carcinoma
    103743920 (Myc)
   05226 Gastric cancer
    103743920 (Myc)
   05216 Thyroid cancer
    103743920 (Myc)
   05221 Acute myeloid leukemia
    103743920 (Myc)
   05220 Chronic myeloid leukemia
    103743920 (Myc)
   05219 Bladder cancer
    103743920 (Myc)
   05213 Endometrial cancer
    103743920 (Myc)
   05224 Breast cancer
    103743920 (Myc)
   05222 Small cell lung cancer
    103743920 (Myc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103743920 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103743920 (Myc)
   05161 Hepatitis B
    103743920 (Myc)
   05160 Hepatitis C
    103743920 (Myc)
   05163 Human cytomegalovirus infection
    103743920 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103743920 (Myc)
   05169 Epstein-Barr virus infection
    103743920 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103743920 (Myc)
   03019 Messenger RNA biogenesis [BR:ngi03019]
    103743920 (Myc)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    103743920 (Myc)
Messenger RNA biogenesis [BR:ngi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103743920 (Myc)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 103743920
NCBI-ProteinID: XP_008843692
LinkDB
Position
Un
AA seq 444 aa
MQTAATMPLNVSFANRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFE
LLPTPPLSPSRRSGLCSPSYVAVAASFSPRGDDDGGGGNFSTADQLEMVTELLGGDMVNQ
SFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSASPSPARGHSGCST
SSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASPDSTAFSSSSDSLLSSESSPRAS
PEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSSTGGHNKAPHSPL
VLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDK
RRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEHKLTS
EKDLLRKRREQLKHKLEQLRNSGA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcagacagccgcgaccatgcccctcaacgtgagcttcgccaacaggaattatgacctg
gactacgactctgtgcagccgtatttcatctgcgacgaggaggaaaacttctaccaccag
cagcagcagagcgagctgcagccgcccgcgcccagcgaggatatctggaagaaattcgag
ctgctgcccaccccgcccctgtccccgagccgccgctccgggctctgttctccttcctat
gtggctgtcgccgcgtccttctccccgaggggggacgacgacggtggcggcggcaacttc
tccactgctgaccagctggagatggtgacagaactgcttggaggagacatggtgaaccag
agctttatctgcgacccggatgacgagaccttcatcaagaacatcattatccaagactgt
atgtggagcggcttctcggccgccgccaagctggtctcagagaagctggcctcctaccag
gctgcgcgcaaagacagcgccagcccgagccccgcccgcgggcacagcggctgctccacc
tccagcctgtacctgcaggacctgagcgccgcggcgtccgagtgcatcgacccctcggtg
gtcttcccctacccgctgaacgacagcagctcgcccaagtcctgcgcctcgcccgactcc
acagccttctcctcgtcctctgactctctgctctcctccgagtcctccccacgggccagc
cccgagccccttgtgctccacgaagagacaccgcccaccaccagcagcgactctgaggaa
gaacaagaagatgaggaagaaatcgatgttgtgtctgtggaaaagaggcagcccccggcc
aaaaggtccgagtcggggtcatctacaggaggccacaacaaagccccacatagcccactg
gtcctcaagaggtgccatgtctccactcatcagcacaattatgcagcacctccctccacg
aggaaggactatccagcagccaagagggctaagttggacagtggcagggttctgaaacag
attagcaacaaccgcaaatgtgccagccccaggtcctcagacacagaggagaacgacaag
aggcggacacacaacgtcttggaacgtcagaggagaaatgagctgaaacggagctttttt
gcccttcgtgaccagatcccagagttggaaaacaatgagaaggcccccaaggtagtcatc
ctcaaaaaagccacagcctatatcctgtctatccaggcagaggagcataagctcacttca
gagaaggacttgctgaggaagcggagagaacagttgaaacacaaactcgaacagcttcga
aactctggtgcgtaa

DBGET integrated database retrieval system